BLASTX nr result
ID: Glycyrrhiza29_contig00030417
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00030417 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011098242.1 PREDICTED: uncharacterized protein LOC105176949 i... 59 3e-08 XP_011098241.1 PREDICTED: uncharacterized protein LOC105176949 i... 59 3e-08 EPS74430.1 hypothetical protein M569_00330 [Genlisea aurea] 58 7e-08 XP_012850574.1 PREDICTED: uncharacterized protein LOC105970312 [... 55 6e-07 XP_016199494.1 PREDICTED: uncharacterized protein LOC107640490 [... 54 2e-06 XP_016169012.1 PREDICTED: zinc finger BED domain-containing prot... 53 3e-06 XP_012858997.1 PREDICTED: zinc finger BED domain-containing prot... 54 3e-06 XP_012837624.1 PREDICTED: zinc finger BED domain-containing prot... 54 3e-06 XP_016207696.1 PREDICTED: zinc finger BED domain-containing prot... 53 4e-06 KZV42131.1 hypothetical protein F511_29810 [Dorcoceras hygrometr... 53 5e-06 XP_012839258.1 PREDICTED: zinc finger BED domain-containing prot... 53 6e-06 XP_015944475.1 PREDICTED: zinc finger BED domain-containing prot... 53 6e-06 XP_013694937.1 PREDICTED: uncharacterized protein LOC106398997 [... 52 9e-06 >XP_011098242.1 PREDICTED: uncharacterized protein LOC105176949 isoform X2 [Sesamum indicum] Length = 277 Score = 58.9 bits (141), Expect = 3e-08 Identities = 29/72 (40%), Positives = 42/72 (58%) Frame = -1 Query: 218 VDDGNDIQILEMRXXXXPSVTSQPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRK 39 ++DGN LE+ S+ K K+ L S+VW + KI ++ EKC+CN CRK Sbjct: 1 MEDGNHETDLEINYHSEGSMGE--KRKREGKLRSKVWQHFTKIMKEDGSCEKCQCNHCRK 58 Query: 38 ILGCSSKNGTTH 3 + CSS++GTTH Sbjct: 59 LFTCSSRSGTTH 70 >XP_011098241.1 PREDICTED: uncharacterized protein LOC105176949 isoform X1 [Sesamum indicum] Length = 278 Score = 58.9 bits (141), Expect = 3e-08 Identities = 29/72 (40%), Positives = 42/72 (58%) Frame = -1 Query: 218 VDDGNDIQILEMRXXXXPSVTSQPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRK 39 ++DGN LE+ S+ K K+ L S+VW + KI ++ EKC+CN CRK Sbjct: 2 MEDGNHETDLEINYHSEGSMGE--KRKREGKLRSKVWQHFTKIMKEDGSCEKCQCNHCRK 59 Query: 38 ILGCSSKNGTTH 3 + CSS++GTTH Sbjct: 60 LFTCSSRSGTTH 71 >EPS74430.1 hypothetical protein M569_00330 [Genlisea aurea] Length = 257 Score = 57.8 bits (138), Expect = 7e-08 Identities = 27/72 (37%), Positives = 38/72 (52%) Frame = -1 Query: 218 VDDGNDIQILEMRXXXXPSVTSQPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRK 39 ++D N + IL+ S T+ KK + S VW + KI ++ KC+CN CRK Sbjct: 1 MEDANSVLILDPNGQSGGSKTTTETVKKDAKVRSIVWQHFSKIIDEDGSCCKCQCNHCRK 60 Query: 38 ILGCSSKNGTTH 3 CS K+GTTH Sbjct: 61 FFTCSKKSGTTH 72 >XP_012850574.1 PREDICTED: uncharacterized protein LOC105970312 [Erythranthe guttata] Length = 256 Score = 55.1 bits (131), Expect = 6e-07 Identities = 27/72 (37%), Positives = 42/72 (58%) Frame = -1 Query: 218 VDDGNDIQILEMRXXXXPSVTSQPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRK 39 ++D N+ LE+ S+ K K+ L S+VW + KI ++ EKC+CN C+K Sbjct: 1 MEDPNNETDLEINYNSEASMGD--KRKRDSKLRSKVWQHFTKITREDGRCEKCQCNHCQK 58 Query: 38 ILGCSSKNGTTH 3 + CSS++GTTH Sbjct: 59 LFTCSSRSGTTH 70 >XP_016199494.1 PREDICTED: uncharacterized protein LOC107640490 [Arachis ipaensis] Length = 565 Score = 54.3 bits (129), Expect = 2e-06 Identities = 19/45 (42%), Positives = 31/45 (68%) Frame = -1 Query: 152 QPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSK 18 +P +K+ + TS+VWN+ +K+GPD+NG E+ C GC+K+ K Sbjct: 137 EPSSKRLRPATSDVWNFFKKLGPDKNGVERSECKGCKKVFKAGGK 181 >XP_016169012.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Arachis ipaensis] Length = 190 Score = 52.8 bits (125), Expect = 3e-06 Identities = 18/45 (40%), Positives = 31/45 (68%) Frame = -1 Query: 152 QPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSK 18 +P +K+ + TS+VWN+ +K+GPD++G E+ C GC+K+ K Sbjct: 25 EPSSKRLRPATSDVWNFFKKLGPDKDGVERAECKGCKKVFKAGGK 69 >XP_012858997.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Erythranthe guttata] Length = 669 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/48 (45%), Positives = 28/48 (58%) Frame = -1 Query: 146 KAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSKNGTTH 3 K K+ L SEVWN+ K+ + KC+CN C+K C SK GTTH Sbjct: 16 KRKRSVKLRSEVWNHFSKVENKDGTKAKCKCNYCKKAFSCPSKGGTTH 63 >XP_012837624.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Erythranthe guttata] Length = 675 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/48 (45%), Positives = 28/48 (58%) Frame = -1 Query: 146 KAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSKNGTTH 3 K K+ L SEVWN+ K+ + KC+CN C+K C SK GTTH Sbjct: 16 KRKRSVKLRSEVWNHFSKVENKDGTKAKCKCNYCKKAFSCPSKGGTTH 63 >XP_016207696.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Arachis ipaensis] Length = 228 Score = 52.8 bits (125), Expect = 4e-06 Identities = 19/49 (38%), Positives = 32/49 (65%) Frame = -1 Query: 152 QPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSKNGTT 6 +P +K+ + TS+VWN+ +K+GPD++G E+ C GC+K+ K T Sbjct: 47 EPSSKRLRRATSDVWNFFKKLGPDKDGVERSECKGCKKVFKAGGKRYDT 95 >KZV42131.1 hypothetical protein F511_29810 [Dorcoceras hygrometricum] Length = 353 Score = 52.8 bits (125), Expect = 5e-06 Identities = 21/48 (43%), Positives = 31/48 (64%) Frame = -1 Query: 146 KAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSKNGTTH 3 K K+ S+VW + K+ ++ EKC+CN C+KI CSS++GTTH Sbjct: 98 KRKRAGKSRSKVWEHFTKLIKEDGRSEKCQCNHCQKIFSCSSRSGTTH 145 >XP_012839258.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Erythranthe guttata] Length = 611 Score = 52.8 bits (125), Expect = 6e-06 Identities = 21/48 (43%), Positives = 27/48 (56%) Frame = -1 Query: 146 KAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSKNGTTH 3 K K+ L SEVWN+ K+ + KC+CN C+K C SK GT H Sbjct: 16 KRKRSVKLRSEVWNHFSKVESKDGAKAKCKCNYCKKAFSCPSKGGTAH 63 >XP_015944475.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis duranensis] Length = 680 Score = 52.8 bits (125), Expect = 6e-06 Identities = 18/45 (40%), Positives = 31/45 (68%) Frame = -1 Query: 152 QPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSK 18 +P +K+ + TS+VWN+ +K+GPD++G E+ C GC+K+ K Sbjct: 25 EPSSKRLRPATSDVWNFFKKLGPDKDGVERAECKGCKKVFKAGGK 69 >XP_013694937.1 PREDICTED: uncharacterized protein LOC106398997 [Brassica napus] Length = 272 Score = 52.0 bits (123), Expect = 9e-06 Identities = 22/52 (42%), Positives = 32/52 (61%) Frame = -1 Query: 158 TSQPKAKKPKTLTSEVWNYLEKIGPDENGDEKCRCNGCRKILGCSSKNGTTH 3 +SQP KK + S+VW Y + D +KCRCN C++I GC+S GT++ Sbjct: 65 SSQPTTKKQSSTRSDVWEYYTRTEDDR---DKCRCNHCQRIFGCASSQGTSN 113