BLASTX nr result
ID: Glycyrrhiza29_contig00030408
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00030408 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019434053.1 PREDICTED: formin-binding protein 4 isoform X2 [L... 54 3e-06 >XP_019434053.1 PREDICTED: formin-binding protein 4 isoform X2 [Lupinus angustifolius] Length = 894 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +2 Query: 221 MTPNRFLPFWQHQGISEVQTVESFIGQQPQNP 316 MTP RF PFWQHQGI EVQ ++ GQQPQNP Sbjct: 1 MTPYRFPPFWQHQGIFEVQAIDVVCGQQPQNP 32