BLASTX nr result
ID: Glycyrrhiza29_contig00030276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00030276 (235 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010109024.1 U-box domain-containing protein 4 [Morus notabili... 62 2e-09 OMO95680.1 Armadillo [Corchorus olitorius] 57 1e-07 XP_007033053.2 PREDICTED: U-box domain-containing protein 2 [The... 55 6e-07 EOY03979.1 ARM repeat superfamily protein [Theobroma cacao] 55 6e-07 XP_014503814.1 PREDICTED: U-box domain-containing protein 3-like... 53 2e-06 XP_007141888.1 hypothetical protein PHAVU_008G234200g [Phaseolus... 53 2e-06 KYP73040.1 U-box domain-containing protein 4 [Cajanus cajan] 52 6e-06 XP_017218392.1 PREDICTED: U-box domain-containing protein 4-like... 52 6e-06 KVH92393.1 Armadillo [Cynara cardunculus var. scolymus] 52 6e-06 >XP_010109024.1 U-box domain-containing protein 4 [Morus notabilis] EXC20664.1 U-box domain-containing protein 4 [Morus notabilis] Length = 400 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQ+RAL+CT+ +D+PIT+SCASEVSSK Sbjct: 366 SMEQSLRHLQRRALVCTSPSDLPITSSCASEVSSK 400 >OMO95680.1 Armadillo [Corchorus olitorius] Length = 385 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRAL+CT T D+PI++SC SEVSSK Sbjct: 352 SMEQSLRHLQQRALVCTPT-DLPISSSCTSEVSSK 385 >XP_007033053.2 PREDICTED: U-box domain-containing protein 2 [Theobroma cacao] Length = 388 Score = 54.7 bits (130), Expect = 6e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRAL+CT T D+PI++SC SEVS K Sbjct: 355 SMEQSLRHLQQRALVCTPT-DLPISSSCTSEVSLK 388 >EOY03979.1 ARM repeat superfamily protein [Theobroma cacao] Length = 388 Score = 54.7 bits (130), Expect = 6e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRAL+CT T D+PI++SC SEVS K Sbjct: 355 SMEQSLRHLQQRALVCTPT-DLPISSSCTSEVSLK 388 >XP_014503814.1 PREDICTED: U-box domain-containing protein 3-like [Vigna radiata var. radiata] Length = 366 Score = 53.1 bits (126), Expect = 2e-06 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRAL+C T +D+PI TSCASEVSSK Sbjct: 334 SMEQSLRHLQQRALVC-TPSDMPI-TSCASEVSSK 366 >XP_007141888.1 hypothetical protein PHAVU_008G234200g [Phaseolus vulgaris] ESW13882.1 hypothetical protein PHAVU_008G234200g [Phaseolus vulgaris] Length = 366 Score = 53.1 bits (126), Expect = 2e-06 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRAL+C T +DIP+ TSCASEVSSK Sbjct: 334 SMEQSLRHLQQRALVC-TPSDIPM-TSCASEVSSK 366 >KYP73040.1 U-box domain-containing protein 4 [Cajanus cajan] Length = 309 Score = 52.0 bits (123), Expect = 6e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRAL+C T +DIPI T+CAS+VSSK Sbjct: 277 SMEQSLRHLQQRALVC-TPSDIPI-TNCASQVSSK 309 >XP_017218392.1 PREDICTED: U-box domain-containing protein 4-like [Daucus carota subsp. sativus] Length = 383 Score = 52.0 bits (123), Expect = 6e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRA++CT T D+PI TSCASEVS K Sbjct: 351 SMEQSLRHLQQRAMVCTPT-DLPI-TSCASEVSLK 383 >KVH92393.1 Armadillo [Cynara cardunculus var. scolymus] Length = 385 Score = 52.0 bits (123), Expect = 6e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 3 SMEQSLRHLQQRALICTTTNDIPITTSCASEVSSK 107 SMEQSLRHLQQRAL+C T +D+ IT++CASEVS K Sbjct: 352 SMEQSLRHLQQRALVC-TPSDLQITSNCASEVSLK 385