BLASTX nr result
ID: Glycyrrhiza29_contig00029978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029978 (208 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012568255.1 PREDICTED: tetratricopeptide repeat protein 38 is... 52 6e-06 XP_004489957.1 PREDICTED: tetratricopeptide repeat protein 38 is... 52 6e-06 >XP_012568255.1 PREDICTED: tetratricopeptide repeat protein 38 isoform X2 [Cicer arietinum] Length = 465 Score = 51.6 bits (122), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 207 LLERGYKVANRPEEASVANERARVLECAYF 118 LLERGYK+A RPEEA +ANE+A+VLE AYF Sbjct: 436 LLERGYKLAKRPEEAGIANEKAKVLESAYF 465 >XP_004489957.1 PREDICTED: tetratricopeptide repeat protein 38 isoform X1 [Cicer arietinum] Length = 468 Score = 51.6 bits (122), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 207 LLERGYKVANRPEEASVANERARVLECAYF 118 LLERGYK+A RPEEA +ANE+A+VLE AYF Sbjct: 439 LLERGYKLAKRPEEAGIANEKAKVLESAYF 468