BLASTX nr result
ID: Glycyrrhiza29_contig00029853
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029853 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002984900.1 hypothetical protein SELMODRAFT_121248 [Selaginel... 56 1e-06 XP_002985957.1 hypothetical protein SELMODRAFT_424924 [Selaginel... 56 1e-06 KYP57581.1 putative membrane protein C776.05 family [Cajanus cajan] 54 4e-06 KRH02660.1 hypothetical protein GLYMA_17G051800 [Glycine max] 54 5e-06 XP_014506095.1 PREDICTED: uncharacterized membrane protein C776.... 54 6e-06 XP_003551153.1 PREDICTED: uncharacterized membrane protein C776.... 54 6e-06 XP_013463471.1 integral membrane protein [Medicago truncatula] K... 54 7e-06 XP_006600447.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 XP_014506094.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 XP_008242189.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 ERN04832.1 hypothetical protein AMTR_s00146p00041410 [Amborella ... 54 7e-06 XP_011622896.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 XP_002868421.1 hypothetical protein ARALYDRAFT_915673 [Arabidops... 54 7e-06 XP_010049439.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 XP_010533045.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 XP_007202149.1 hypothetical protein PRUPE_ppa007084mg [Prunus pe... 54 7e-06 XP_007202150.1 hypothetical protein PRUPE_ppa007084mg [Prunus pe... 54 7e-06 XP_009361664.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 XP_008388493.1 PREDICTED: uncharacterized membrane protein C776.... 54 7e-06 JAT57004.1 putative membrane protein C776.05 [Anthurium amnicola] 54 7e-06 >XP_002984900.1 hypothetical protein SELMODRAFT_121248 [Selaginella moellendorffii] EFJ14150.1 hypothetical protein SELMODRAFT_121248 [Selaginella moellendorffii] Length = 417 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPGKLDPTL 263 IVWRCSLVFSS+DKI+SVLIHLLPGK T+ Sbjct: 121 IVWRCSLVFSSIDKIISVLIHLLPGKFHSTV 151 >XP_002985957.1 hypothetical protein SELMODRAFT_424924 [Selaginella moellendorffii] EFJ13134.1 hypothetical protein SELMODRAFT_424924 [Selaginella moellendorffii] Length = 435 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPGKLDPTL 263 IVWRCSLVFSS+DKI+SVLIHLLPGK T+ Sbjct: 138 IVWRCSLVFSSIDKIISVLIHLLPGKFHSTV 168 >KYP57581.1 putative membrane protein C776.05 family [Cajanus cajan] Length = 217 Score = 53.5 bits (127), Expect = 4e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 16 IVWRCSLVFSSLDKIVSVLIHLLPG 40 >KRH02660.1 hypothetical protein GLYMA_17G051800 [Glycine max] Length = 249 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 43 IVWRCSLVFSSLDKIVSVLIHLLPG 67 >XP_014506095.1 PREDICTED: uncharacterized membrane protein C776.05-like isoform X2 [Vigna radiata var. radiata] Length = 317 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 105 IVWRCSLVFSSLDKIVSVLIHLLPG 129 >XP_003551153.1 PREDICTED: uncharacterized membrane protein C776.05 isoform X2 [Glycine max] KRH02659.1 hypothetical protein GLYMA_17G051800 [Glycine max] Length = 331 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 125 IVWRCSLVFSSLDKIVSVLIHLLPG 149 >XP_013463471.1 integral membrane protein [Medicago truncatula] KEH37506.1 integral membrane protein [Medicago truncatula] Length = 348 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 144 IVWRCSLVFSSLDKIVSVLIHLLPG 168 >XP_006600447.1 PREDICTED: uncharacterized membrane protein C776.05 isoform X1 [Glycine max] KHN17698.1 Putative membrane protein [Glycine soja] KRH02658.1 hypothetical protein GLYMA_17G051800 [Glycine max] Length = 363 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 157 IVWRCSLVFSSLDKIVSVLIHLLPG 181 >XP_014506094.1 PREDICTED: uncharacterized membrane protein C776.05-like isoform X1 [Vigna radiata var. radiata] Length = 370 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 158 IVWRCSLVFSSLDKIVSVLIHLLPG 182 >XP_008242189.1 PREDICTED: uncharacterized membrane protein C776.05 [Prunus mume] Length = 375 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 154 IVWRCSLVFSSLDKIVSVLIHLLPG 178 >ERN04832.1 hypothetical protein AMTR_s00146p00041410 [Amborella trichopoda] Length = 377 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 142 IVWRCSLVFSSLDKIVSVLIHLLPG 166 >XP_011622896.1 PREDICTED: uncharacterized membrane protein C776.05 [Amborella trichopoda] XP_011622897.1 PREDICTED: uncharacterized membrane protein C776.05 [Amborella trichopoda] Length = 379 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 144 IVWRCSLVFSSLDKIVSVLIHLLPG 168 >XP_002868421.1 hypothetical protein ARALYDRAFT_915673 [Arabidopsis lyrata subsp. lyrata] EFH44680.1 hypothetical protein ARALYDRAFT_915673 [Arabidopsis lyrata subsp. lyrata] Length = 379 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 164 IVWRCSLVFSSLDKIVSVLIHLLPG 188 >XP_010049439.1 PREDICTED: uncharacterized membrane protein C776.05 [Eucalyptus grandis] KCW82025.1 hypothetical protein EUGRSUZ_C03403 [Eucalyptus grandis] Length = 381 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 158 IVWRCSLVFSSLDKIVSVLIHLLPG 182 >XP_010533045.1 PREDICTED: uncharacterized membrane protein C776.05 [Tarenaya hassleriana] Length = 382 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 165 IVWRCSLVFSSLDKIVSVLIHLLPG 189 >XP_007202149.1 hypothetical protein PRUPE_ppa007084mg [Prunus persica] ONH97656.1 hypothetical protein PRUPE_7G204000 [Prunus persica] Length = 382 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 161 IVWRCSLVFSSLDKIVSVLIHLLPG 185 >XP_007202150.1 hypothetical protein PRUPE_ppa007084mg [Prunus persica] ONH97655.1 hypothetical protein PRUPE_7G204000 [Prunus persica] Length = 383 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 162 IVWRCSLVFSSLDKIVSVLIHLLPG 186 >XP_009361664.1 PREDICTED: uncharacterized membrane protein C776.05-like isoform X1 [Pyrus x bretschneideri] XP_009361665.1 PREDICTED: uncharacterized membrane protein C776.05-like isoform X2 [Pyrus x bretschneideri] Length = 384 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 162 IVWRCSLVFSSLDKIVSVLIHLLPG 186 >XP_008388493.1 PREDICTED: uncharacterized membrane protein C776.05-like [Malus domestica] XP_008344028.1 PREDICTED: uncharacterized membrane protein C776.05-like [Malus domestica] Length = 385 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 162 IVWRCSLVFSSLDKIVSVLIHLLPG 186 >JAT57004.1 putative membrane protein C776.05 [Anthurium amnicola] Length = 392 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 355 IVWRCSLVFSSLDKIVSVLIHLLPG 281 IVWRCSLVFSSLDKIVSVLIHLLPG Sbjct: 172 IVWRCSLVFSSLDKIVSVLIHLLPG 196