BLASTX nr result
ID: Glycyrrhiza29_contig00029802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029802 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU41979.1 hypothetical protein TSUD_306850, partial [Trifolium ... 59 6e-08 XP_006578172.1 PREDICTED: uncharacterized protein LOC100790928 [... 55 2e-07 XP_004517225.2 PREDICTED: coiled-coil domain-containing protein ... 56 8e-07 KHN08100.1 Gibberellin 20 oxidase 1 [Glycine soja] 55 1e-06 XP_013461902.1 paramyosin-like protein [Medicago truncatula] KEH... 54 4e-06 XP_016170574.1 PREDICTED: coiled-coil domain-containing protein ... 54 5e-06 KYP39562.1 Coiled-coil domain-containing protein 93 [Cajanus cajan] 53 9e-06 >GAU41979.1 hypothetical protein TSUD_306850, partial [Trifolium subterraneum] Length = 284 Score = 58.9 bits (141), Expect = 6e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 2 ELERKIANDCDSESLTDGLHHSFSESLERVGLMKKGVQRHL 124 ELERK+ +CD+ SLTDGLHHSFSE LERV LMKK + L Sbjct: 106 ELERKLEYECDNNSLTDGLHHSFSERLERVDLMKKELAARL 146 >XP_006578172.1 PREDICTED: uncharacterized protein LOC100790928 [Glycine max] KRH61840.1 hypothetical protein GLYMA_04G070700 [Glycine max] Length = 132 Score = 55.5 bits (132), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 ELERKIANDCDSESLTDGLHHSFSESLERVGLMKK 106 ELERKI NDCD+E+L D L+HSFSE +E+V LMKK Sbjct: 60 ELERKITNDCDTENLPDELYHSFSELIEKVNLMKK 94 >XP_004517225.2 PREDICTED: coiled-coil domain-containing protein 93-like [Cicer arietinum] Length = 284 Score = 55.8 bits (133), Expect = 8e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 5 LERKIANDC-DSESLTDGLHHSFSESLERVGLMKKGVQRHL 124 LE KIAND DS+SLTDGLHHSFSESLERV LMKK + L Sbjct: 204 LEIKIANDRNDSKSLTDGLHHSFSESLERVNLMKKELAARL 244 >KHN08100.1 Gibberellin 20 oxidase 1 [Glycine soja] Length = 581 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 ELERKIANDCDSESLTDGLHHSFSESLERVGLMKK 106 ELERKI NDCD+E+L D L+HSFSE +E+V LMKK Sbjct: 382 ELERKITNDCDTENLPDELYHSFSELIEKVNLMKK 416 >XP_013461902.1 paramyosin-like protein [Medicago truncatula] KEH35937.1 paramyosin-like protein [Medicago truncatula] Length = 266 Score = 53.9 bits (128), Expect = 4e-06 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = +2 Query: 2 ELERKIANDCD--SESLTDGLHHSFSESLERVGLMKKGVQRHL 124 ELERKIANDC S+SLTDGLHHS +ES ER LMKK + L Sbjct: 72 ELERKIANDCGHGSKSLTDGLHHSLTESPERFDLMKKELAARL 114 >XP_016170574.1 PREDICTED: coiled-coil domain-containing protein 93 [Arachis ipaensis] Length = 403 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 2 ELERKIANDCDSESLTDGLHHSFSESLERVGLMKK 106 ELE KIANDCDS+SL+DGLHHS SE E+V L KK Sbjct: 210 ELEAKIANDCDSKSLSDGLHHSISELHEKVHLEKK 244 >KYP39562.1 Coiled-coil domain-containing protein 93 [Cajanus cajan] Length = 248 Score = 52.8 bits (125), Expect = 9e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 2 ELERKIANDCDSESLTDGLHHSFSESLERVGLMKKGVQRHL 124 ELERKI ND D+E+L+DGLH SF+E +E+V LMKK + L Sbjct: 60 ELERKITNDSDNENLSDGLHCSFTELIEKVNLMKKQLAARL 100