BLASTX nr result
ID: Glycyrrhiza29_contig00029788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029788 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016903347.1 PREDICTED: coiled-coil domain-containing protein ... 92 2e-22 XP_008466970.1 PREDICTED: coiled-coil domain-containing protein ... 92 2e-22 CBI14833.3 unnamed protein product, partial [Vitis vinifera] 93 6e-22 XP_019074265.1 PREDICTED: coiled-coil domain-containing protein ... 93 6e-22 XP_003635597.1 PREDICTED: coiled-coil domain-containing protein ... 93 6e-22 XP_006370046.1 hypothetical protein POPTR_0001s38700g [Populus t... 93 2e-21 XP_008346155.1 PREDICTED: coiled-coil domain-containing protein ... 93 2e-21 ACJ83312.1 unknown [Medicago truncatula] 90 3e-21 XP_004488650.1 PREDICTED: coiled-coil domain-containing protein ... 94 6e-21 XP_018848671.1 PREDICTED: coiled-coil domain-containing protein ... 92 7e-21 ACU23145.1 unknown [Glycine max] KRH21797.1 hypothetical protein... 92 7e-21 XP_010095478.1 hypothetical protein L484_014905 [Morus notabilis... 94 8e-21 XP_004294098.1 PREDICTED: coiled-coil domain-containing protein ... 94 8e-21 GAV60881.1 DUF572 domain-containing protein [Cephalotus follicul... 93 8e-21 XP_011006709.1 PREDICTED: coiled-coil domain-containing protein ... 93 8e-21 KDO45648.1 hypothetical protein CISIN_1g0203401mg [Citrus sinensis] 93 8e-21 XP_006477925.1 PREDICTED: coiled-coil domain-containing protein ... 93 8e-21 XP_006442249.1 hypothetical protein CICLE_v10021131mg [Citrus cl... 93 8e-21 XP_002298914.2 hypothetical protein POPTR_0001s38700g [Populus t... 93 8e-21 XP_002317366.2 hypothetical protein POPTR_0011s09840g [Populus t... 93 8e-21 >XP_016903347.1 PREDICTED: coiled-coil domain-containing protein 94 homolog, partial [Cucumis melo] Length = 111 Score = 92.4 bits (228), Expect = 2e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQ+KVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQMKVRMMLPMSIRC 43 >XP_008466970.1 PREDICTED: coiled-coil domain-containing protein 94 homolog, partial [Cucumis melo] Length = 116 Score = 92.4 bits (228), Expect = 2e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQ+KVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQMKVRMMLPMSIRC 43 >CBI14833.3 unnamed protein product, partial [Vitis vinifera] Length = 183 Score = 93.2 bits (230), Expect = 6e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_019074265.1 PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X2 [Vitis vinifera] Length = 184 Score = 93.2 bits (230), Expect = 6e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_003635597.1 PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X1 [Vitis vinifera] Length = 184 Score = 93.2 bits (230), Expect = 6e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_006370046.1 hypothetical protein POPTR_0001s38700g [Populus trichocarpa] ERP66615.1 hypothetical protein POPTR_0001s38700g [Populus trichocarpa] Length = 230 Score = 93.2 bits (230), Expect = 2e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_008346155.1 PREDICTED: coiled-coil domain-containing protein 94 homolog [Malus domestica] Length = 234 Score = 93.2 bits (230), Expect = 2e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >ACJ83312.1 unknown [Medicago truncatula] Length = 122 Score = 89.7 bits (221), Expect = 3e-21 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDP+KLPRVRRPKN QIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPAKLPRVRRPKNLQIKVRMMLPMSIRC 43 >XP_004488650.1 PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] XP_004488651.1 PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] XP_012567716.1 PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] Length = 330 Score = 93.6 bits (231), Expect = 6e-21 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 43 >XP_018848671.1 PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X2 [Juglans regia] Length = 271 Score = 92.4 bits (228), Expect = 7e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQ+KVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQMKVRMMLPMSIRC 43 >ACU23145.1 unknown [Glycine max] KRH21797.1 hypothetical protein GLYMA_13G259300 [Glycine max] Length = 252 Score = 92.0 bits (227), Expect = 7e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRC 43 >XP_010095478.1 hypothetical protein L484_014905 [Morus notabilis] EXB60452.1 hypothetical protein L484_014905 [Morus notabilis] Length = 351 Score = 93.6 bits (231), Expect = 8e-21 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 43 >XP_004294098.1 PREDICTED: coiled-coil domain-containing protein 94 homolog [Fragaria vesca subsp. vesca] Length = 353 Score = 93.6 bits (231), Expect = 8e-21 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 43 >GAV60881.1 DUF572 domain-containing protein [Cephalotus follicularis] Length = 325 Score = 93.2 bits (230), Expect = 8e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_011006709.1 PREDICTED: coiled-coil domain-containing protein 94 homolog [Populus euphratica] Length = 327 Score = 93.2 bits (230), Expect = 8e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >KDO45648.1 hypothetical protein CISIN_1g0203401mg [Citrus sinensis] Length = 327 Score = 93.2 bits (230), Expect = 8e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_006477925.1 PREDICTED: coiled-coil domain-containing protein 94 homolog [Citrus sinensis] Length = 327 Score = 93.2 bits (230), Expect = 8e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_006442249.1 hypothetical protein CICLE_v10021131mg [Citrus clementina] ESR55489.1 hypothetical protein CICLE_v10021131mg [Citrus clementina] Length = 327 Score = 93.2 bits (230), Expect = 8e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_002298914.2 hypothetical protein POPTR_0001s38700g [Populus trichocarpa] EEE83719.2 hypothetical protein POPTR_0001s38700g [Populus trichocarpa] Length = 327 Score = 93.2 bits (230), Expect = 8e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43 >XP_002317366.2 hypothetical protein POPTR_0011s09840g [Populus trichocarpa] XP_011044944.1 PREDICTED: coiled-coil domain-containing protein 94 homolog [Populus euphratica] ABK95462.1 unknown [Populus trichocarpa] EEE97978.2 hypothetical protein POPTR_0011s09840g [Populus trichocarpa] Length = 327 Score = 93.2 bits (230), Expect = 8e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 142 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRC 270 MGERKVLNKYYPPDFDPSKLPR+RRPKNQQIKVRMMLPMSIRC Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRC 43