BLASTX nr result
ID: Glycyrrhiza29_contig00029504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029504 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU42896.1 hypothetical protein TSUD_232070 [Trifolium subterran... 52 7e-07 >GAU42896.1 hypothetical protein TSUD_232070 [Trifolium subterraneum] Length = 106 Score = 52.4 bits (124), Expect = 7e-07 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = +3 Query: 63 SSQHTYREGNQVANFLANSAHSLPLGLHCFNLLLEGCTYALWQDFA 200 S QHTYR+ NQVAN++A+ A ++P+G+H ++ GC LWQD A Sbjct: 48 SFQHTYRQVNQVANWIASYALTIPMGIHILHIPPPGCISLLWQDNA 93