BLASTX nr result
ID: Glycyrrhiza29_contig00029380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029380 (470 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016191184.1 PREDICTED: DELLA protein GAIP-B-like [Arachis ipa... 62 3e-08 XP_015957883.1 PREDICTED: DELLA protein GAIP-B-like [Arachis dur... 62 3e-08 AGK07287.1 GAI1 [Rosa hybrid cultivar] 60 9e-08 XP_015895446.1 PREDICTED: DELLA protein GAIP-B-like [Ziziphus ju... 60 1e-07 XP_010101954.1 hypothetical protein L484_011971 [Morus notabilis... 60 2e-07 ABL61270.1 GAI1 [Malus hupehensis] 60 2e-07 XP_017971822.1 PREDICTED: DELLA protein GAIP-B [Theobroma cacao] 59 2e-07 EOY01029.1 GRAS family transcription factor family protein [Theo... 59 2e-07 AFK49468.1 unknown [Medicago truncatula] 57 3e-07 XP_007225630.1 hypothetical protein PRUPE_ppa005944mg [Prunus pe... 59 3e-07 XP_019463957.1 PREDICTED: DELLA protein GAIP-B-like [Lupinus ang... 59 3e-07 OMO99752.1 Transcription factor GRAS [Corchorus olitorius] 59 3e-07 ADH53780.1 GAI1, partial [Malus domestica] 59 3e-07 Q6EI06.1 RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP;... 59 3e-07 XP_008467128.1 PREDICTED: DELLA protein GAIP-B [Cucumis melo] 59 3e-07 XP_004150593.1 PREDICTED: DELLA protein GAIP-B [Cucumis sativus]... 59 3e-07 XP_004298516.1 PREDICTED: DELLA protein GAIP [Fragaria vesca sub... 59 3e-07 OMO60646.1 Transcription factor GRAS [Corchorus capsularis] 59 3e-07 AQQ12218.1 DELLA protein [Prunus salicina] 59 3e-07 XP_008221422.1 PREDICTED: DELLA protein GAIP-B [Prunus mume] 59 3e-07 >XP_016191184.1 PREDICTED: DELLA protein GAIP-B-like [Arachis ipaensis] Length = 603 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS ++V VNSVF+LH+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 422 PSETEAVAVNSVFELHKLLARPGAVEKVLSVVRQIRPEIVTVV 464 >XP_015957883.1 PREDICTED: DELLA protein GAIP-B-like [Arachis duranensis] Length = 603 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS ++V VNSVF+LH+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 422 PSETEAVAVNSVFELHKLLARPGAVEKVLSVVRQIRPEIVTVV 464 >AGK07287.1 GAI1 [Rosa hybrid cultivar] Length = 618 Score = 60.5 bits (145), Expect = 9e-08 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA+DKV+SVV+Q++P+IVTVV Sbjct: 437 PSEVESVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTVV 479 >XP_015895446.1 PREDICTED: DELLA protein GAIP-B-like [Ziziphus jujuba] Length = 502 Score = 60.1 bits (144), Expect = 1e-07 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVVRQI+P+IVT+V Sbjct: 321 PSEVESVAVNSVFELHKLLARPGAIEKVLSVVRQIKPEIVTMV 363 >XP_010101954.1 hypothetical protein L484_011971 [Morus notabilis] EXB90878.1 hypothetical protein L484_011971 [Morus notabilis] Length = 477 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 295 PSETESVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 337 >ABL61270.1 GAI1 [Malus hupehensis] Length = 638 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 454 PSEAESVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 496 >XP_017971822.1 PREDICTED: DELLA protein GAIP-B [Theobroma cacao] Length = 615 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS ++V VNSVF+LH+LL PGA+DKV+SVV+Q++P+IVT+V Sbjct: 433 PSEGEAVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTIV 475 >EOY01029.1 GRAS family transcription factor family protein [Theobroma cacao] Length = 615 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS ++V VNSVF+LH+LL PGA+DKV+SVV+Q++P+IVT+V Sbjct: 433 PSEGEAVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTIV 475 >AFK49468.1 unknown [Medicago truncatula] Length = 180 Score = 57.4 bits (137), Expect = 3e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 268 KSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 +SV VNSVF+LH+L PGAL+KV SV+RQIRP+IVTVV Sbjct: 80 ESVAVNSVFELHKLNARPGALEKVFSVIRQIRPEIVTVV 118 >XP_007225630.1 hypothetical protein PRUPE_ppa005944mg [Prunus persica] ONI31763.1 hypothetical protein PRUPE_1G329600 [Prunus persica] Length = 436 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 255 PSEVESVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 297 >XP_019463957.1 PREDICTED: DELLA protein GAIP-B-like [Lupinus angustifolius] OIW00657.1 hypothetical protein TanjilG_09138 [Lupinus angustifolius] Length = 550 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+ H+LL PGA++KV+SVV+QI+P+IVTVV Sbjct: 370 PSETESVAVNSVFEFHKLLARPGAVEKVLSVVKQIKPEIVTVV 412 >OMO99752.1 Transcription factor GRAS [Corchorus olitorius] Length = 567 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS ++V VNSVF+LH+LL PGA+DKV+SVV+Q++P+IVT+V Sbjct: 384 PSEVEAVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTIV 426 >ADH53780.1 GAI1, partial [Malus domestica] Length = 570 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 400 PSEVESVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 442 >Q6EI06.1 RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP; Short=GAIP; AltName: Full=Gibberellic acid-insensitive phloem protein AAQ96164.1 gibberellic acid insensitive phloem [Cucurbita maxima] Length = 579 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 398 PSEVESVVVNSVFELHQLLARPGAIEKVLSVVKQMKPEIVTVV 440 >XP_008467128.1 PREDICTED: DELLA protein GAIP-B [Cucumis melo] Length = 586 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGAL+KV+SVV+Q++P+I+TVV Sbjct: 405 PSEVESVVVNSVFELHKLLARPGALEKVLSVVKQMKPEIMTVV 447 >XP_004150593.1 PREDICTED: DELLA protein GAIP-B [Cucumis sativus] CBX88046.1 gibberellin DELLA protein, partial [Cucumis sativus] KGN51488.1 DELLA protein GAIP-B [Cucumis sativus] Length = 586 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGAL+KV+SVV+Q++P+I+TVV Sbjct: 405 PSEVESVVVNSVFELHKLLARPGALEKVLSVVKQMKPEIMTVV 447 >XP_004298516.1 PREDICTED: DELLA protein GAIP [Fragaria vesca subsp. vesca] Length = 611 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 430 PSEVESVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 472 >OMO60646.1 Transcription factor GRAS [Corchorus capsularis] Length = 625 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS ++V VNSVF+LH+LL PGA+DKV+SVV+Q++P+IVT+V Sbjct: 442 PSEVEAVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTIV 484 >AQQ12218.1 DELLA protein [Prunus salicina] Length = 633 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 452 PSEVESVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 494 >XP_008221422.1 PREDICTED: DELLA protein GAIP-B [Prunus mume] Length = 633 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 256 PSLRKSVFVNSVFKLHRLLIHPGALDKVISVVRQIRPKIVTVV 384 PS +SV VNSVF+LH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 452 PSEVESVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 494