BLASTX nr result
ID: Glycyrrhiza29_contig00029245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029245 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU81330.1 Transcription factor RAX3, partial [Noccaea caerulesc... 57 3e-09 EEF38642.1 r2r3-myb transcription factor, putative [Ricinus comm... 55 1e-08 KGN55306.1 hypothetical protein Csa_4G645320 [Cucumis sativus] 55 1e-08 CDY08749.1 BnaA06g24750D [Brassica napus] 55 1e-08 EEF52221.1 r2r3-myb transcription factor, putative [Ricinus comm... 55 1e-08 KGN48644.1 hypothetical protein Csa_6G496960 [Cucumis sativus] A... 55 1e-08 XP_006384946.1 hypothetical protein POPTR_0004s22490g, partial [... 59 1e-08 EEF42898.1 r2r3-myb transcription factor, putative [Ricinus comm... 55 2e-08 EEF36154.1 r2r3-myb transcription factor, putative [Ricinus comm... 59 2e-08 KGN62415.1 hypothetical protein Csa_2G352940 [Cucumis sativus] 55 3e-08 NP_001324751.1 Duplicated homeodomain-like superfamily protein [... 58 3e-08 XP_015577582.1 PREDICTED: transcription factor RAX2 [Ricinus com... 55 4e-08 JAU07607.1 Transcription factor RAX3, partial [Noccaea caerulesc... 58 5e-08 JAU62401.1 Transcription factor RAX3, partial [Noccaea caerulesc... 58 5e-08 JAU39980.1 Transcription factor RAX3, partial [Noccaea caerulesc... 58 5e-08 JAU92469.1 Transcription factor RAX3, partial [Noccaea caerulesc... 58 5e-08 ABH02916.1 MYB transcription factor MYB157, partial [Glycine max] 55 5e-08 EPS63291.1 hypothetical protein M569_11493, partial [Genlisea au... 55 5e-08 EYU42422.1 hypothetical protein MIMGU_mgv1a0181341mg, partial [E... 53 6e-08 JAU16641.1 Transcription factor RAX3, partial [Noccaea caerulesc... 57 6e-08 >JAU81330.1 Transcription factor RAX3, partial [Noccaea caerulescens] Length = 80 Score = 57.4 bits (137), Expect = 3e-09 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +2 Query: 86 LRGLINWRNQTRSIL*VKSRESNMGRAPCCDKANVKKGPWSPEED 220 LR L ++Q RS + MGRAPCCDKANVKKGPWSPEED Sbjct: 35 LRFLTKKKDQLRSR--TRKLHQEMGRAPCCDKANVKKGPWSPEED 77 >EEF38642.1 r2r3-myb transcription factor, putative [Ricinus communis] Length = 49 Score = 55.1 bits (131), Expect = 1e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >KGN55306.1 hypothetical protein Csa_4G645320 [Cucumis sativus] Length = 51 Score = 55.1 bits (131), Expect = 1e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >CDY08749.1 BnaA06g24750D [Brassica napus] Length = 51 Score = 55.1 bits (131), Expect = 1e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >EEF52221.1 r2r3-myb transcription factor, putative [Ricinus communis] Length = 53 Score = 55.1 bits (131), Expect = 1e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >KGN48644.1 hypothetical protein Csa_6G496960 [Cucumis sativus] ALN97495.1 DNA binding / transcription factor [Cucumis sativus] ALN97499.1 DNA binding / transcription factor [Cucumis sativus] ALN97503.1 DNA binding / transcription factor [Cucumis sativus] ALN97507.1 DNA binding / transcription factor [Cucumis sativus] ALN97511.1 DNA binding / transcription factor [Cucumis sativus] ALN97515.1 DNA binding / transcription factor [Cucumis sativus] ALN97519.1 DNA binding / transcription factor [Cucumis sativus] Length = 55 Score = 55.1 bits (131), Expect = 1e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >XP_006384946.1 hypothetical protein POPTR_0004s22490g, partial [Populus trichocarpa] ERP62743.1 hypothetical protein POPTR_0004s22490g, partial [Populus trichocarpa] Length = 378 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 137 KSRESNMGRAPCCDKANVKKGPWSPEED 220 + RE MGRAPCCDKANVKKGPWSPEED Sbjct: 11 REREREMGRAPCCDKANVKKGPWSPEED 38 >EEF42898.1 r2r3-myb transcription factor, putative [Ricinus communis] Length = 65 Score = 55.1 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >EEF36154.1 r2r3-myb transcription factor, putative [Ricinus communis] Length = 417 Score = 58.5 bits (140), Expect = 2e-08 Identities = 35/61 (57%), Positives = 38/61 (62%), Gaps = 2/61 (3%) Frame = +2 Query: 44 LFLSLNKNPLSAPFLRGLINWRNQTRSIL*VKSRES--NMGRAPCCDKANVKKGPWSPEE 217 LFL +N PFL N QTR + RE+ MGRAPCCDKANVKKGPWSPEE Sbjct: 47 LFLPIN---FGHPFLIFPNNLLAQTR-----RERENIEEMGRAPCCDKANVKKGPWSPEE 98 Query: 218 D 220 D Sbjct: 99 D 99 >KGN62415.1 hypothetical protein Csa_2G352940 [Cucumis sativus] Length = 89 Score = 55.1 bits (131), Expect = 3e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >NP_001324751.1 Duplicated homeodomain-like superfamily protein [Arabidopsis thaliana] ANM62605.1 Duplicated homeodomain-like superfamily protein [Arabidopsis thaliana] Length = 339 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/61 (45%), Positives = 37/61 (60%) Frame = +2 Query: 38 LVLFLSLNKNPLSAPFLRGLINWRNQTRSIL*VKSRESNMGRAPCCDKANVKKGPWSPEE 217 L L ++ +N S PF ++ + L + + MGRAPCCDKANVK+GPWSPEE Sbjct: 3 LSLIITEPENSFSFPFFSFKKQNKDISTKTLRPRETDREMGRAPCCDKANVKRGPWSPEE 62 Query: 218 D 220 D Sbjct: 63 D 63 >XP_015577582.1 PREDICTED: transcription factor RAX2 [Ricinus communis] Length = 100 Score = 55.1 bits (131), Expect = 4e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >JAU07607.1 Transcription factor RAX3, partial [Noccaea caerulescens] Length = 427 Score = 57.8 bits (138), Expect = 5e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 137 KSRESNMGRAPCCDKANVKKGPWSPEED 220 +S+ MGRAPCCDKANVKKGPWSPEED Sbjct: 53 ESKNKKMGRAPCCDKANVKKGPWSPEED 80 >JAU62401.1 Transcription factor RAX3, partial [Noccaea caerulescens] Length = 435 Score = 57.8 bits (138), Expect = 5e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 137 KSRESNMGRAPCCDKANVKKGPWSPEED 220 +S+ MGRAPCCDKANVKKGPWSPEED Sbjct: 61 ESKNKKMGRAPCCDKANVKKGPWSPEED 88 >JAU39980.1 Transcription factor RAX3, partial [Noccaea caerulescens] Length = 448 Score = 57.8 bits (138), Expect = 5e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 137 KSRESNMGRAPCCDKANVKKGPWSPEED 220 +S+ MGRAPCCDKANVKKGPWSPEED Sbjct: 74 ESKNKKMGRAPCCDKANVKKGPWSPEED 101 >JAU92469.1 Transcription factor RAX3, partial [Noccaea caerulescens] Length = 450 Score = 57.8 bits (138), Expect = 5e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 137 KSRESNMGRAPCCDKANVKKGPWSPEED 220 +S+ MGRAPCCDKANVKKGPWSPEED Sbjct: 76 ESKNKKMGRAPCCDKANVKKGPWSPEED 103 >ABH02916.1 MYB transcription factor MYB157, partial [Glycine max] Length = 112 Score = 55.1 bits (131), Expect = 5e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >EPS63291.1 hypothetical protein M569_11493, partial [Genlisea aurea] Length = 118 Score = 55.1 bits (131), Expect = 5e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPWSPEED Sbjct: 1 MGRAPCCDKANVKKGPWSPEED 22 >EYU42422.1 hypothetical protein MIMGU_mgv1a0181341mg, partial [Erythranthe guttata] Length = 45 Score = 53.1 bits (126), Expect = 6e-08 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 155 MGRAPCCDKANVKKGPWSPEED 220 MGRAPCCDKANVKKGPW PEED Sbjct: 1 MGRAPCCDKANVKKGPWCPEED 22 >JAU16641.1 Transcription factor RAX3, partial [Noccaea caerulescens] Length = 358 Score = 57.4 bits (137), Expect = 6e-08 Identities = 26/42 (61%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +2 Query: 101 NWRNQTRSIL*VKSRES--NMGRAPCCDKANVKKGPWSPEED 220 N +N+ ++ +K ++S MGRAPCCDKANVKKGPWSPEED Sbjct: 7 NKKNKNKNKNKIKKQKSCKKMGRAPCCDKANVKKGPWSPEED 48