BLASTX nr result
ID: Glycyrrhiza29_contig00029208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00029208 (590 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMT03626.1 hypothetical protein BVRB_8g190380 [Beta vulgaris sub... 51 6e-06 >KMT03626.1 hypothetical protein BVRB_8g190380 [Beta vulgaris subsp. vulgaris] Length = 37 Score = 51.2 bits (121), Expect = 6e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 414 MLGSSYAIHKGH*CFDELCIWHTGSQAHTHMY 319 MLGSSYAIH GH FD LC WHTGSQA+ Y Sbjct: 1 MLGSSYAIHGGHRLFDGLCEWHTGSQAYNIKY 32