BLASTX nr result
ID: Glycyrrhiza29_contig00028906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00028906 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SDD52944.1 tyrosine recombinase XerD subunit [Bradyrhizobium sp.... 67 5e-11 WP_057015546.1 MULTISPECIES: site-specific tyrosine recombinase ... 67 5e-11 WP_051448064.1 site-specific tyrosine recombinase XerD [Bradyrhi... 67 5e-11 WP_051376440.1 site-specific tyrosine recombinase XerD [Bradyrhi... 67 5e-11 WP_051003248.1 site-specific tyrosine recombinase XerD [Bradyrhi... 67 5e-11 WP_050383203.1 site-specific tyrosine recombinase XerD [Bradyrhi... 67 5e-11 WP_016843562.1 site-specific tyrosine recombinase XerD [Bradyrhi... 67 5e-11 WP_069280511.1 site-specific tyrosine recombinase XerD [Bradyrhi... 66 2e-10 SED47063.1 tyrosine recombinase XerD subunit [Bradyrhizobium ery... 66 2e-10 WP_076864022.1 site-specific tyrosine recombinase XerD [Bradyrhi... 65 2e-10 WP_051346102.1 site-specific tyrosine recombinase XerD [Bradyrhi... 65 3e-10 ERF80028.1 tyrosine recombinase xerD [Bradyrhizobium sp. DFCI-1] 65 5e-10 KIU49906.1 recombinase XerD [Bradyrhizobium elkanii] 64 6e-10 WP_050405943.1 site-specific tyrosine recombinase XerD [Bradyrhi... 63 2e-09 WP_051389813.1 site-specific tyrosine recombinase XerD [Bradyrhi... 62 3e-09 WP_044536342.1 site-specific tyrosine recombinase XerD [Bradyrhi... 62 6e-09 WP_050630732.1 site-specific tyrosine recombinase XerD [Bradyrhi... 61 1e-08 WP_074132213.1 site-specific tyrosine recombinase XerD [Bradyrhi... 61 1e-08 WP_029585080.1 site-specific tyrosine recombinase XerD [Bradyrhi... 61 1e-08 WP_066509009.1 site-specific tyrosine recombinase XerD [Bradyrhi... 61 1e-08 >SDD52944.1 tyrosine recombinase XerD subunit [Bradyrhizobium sp. R5] Length = 327 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 56 >WP_057015546.1 MULTISPECIES: site-specific tyrosine recombinase XerD [Bradyrhizobium] KRQ12336.1 recombinase XerD [Bradyrhizobium pachyrhizi] OMI14731.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. UFLA 03-321] Length = 327 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 56 >WP_051448064.1 site-specific tyrosine recombinase XerD [Bradyrhizobium elkanii] Length = 327 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 56 >WP_051376440.1 site-specific tyrosine recombinase XerD [Bradyrhizobium elkanii] Length = 327 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 56 >WP_051003248.1 site-specific tyrosine recombinase XerD [Bradyrhizobium elkanii] Length = 327 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 56 >WP_050383203.1 site-specific tyrosine recombinase XerD [Bradyrhizobium pachyrhizi] Length = 327 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 56 >WP_016843562.1 site-specific tyrosine recombinase XerD [Bradyrhizobium elkanii] OIM93120.1 site-specific tyrosine recombinase XerD [Bradyrhizobium elkanii] Length = 327 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 56 >WP_069280511.1 site-specific tyrosine recombinase XerD [Bradyrhizobium elkanii] ODM71049.1 recombinase XerD [Bradyrhizobium elkanii] ODM80483.1 recombinase XerD [Bradyrhizobium elkanii] Length = 327 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYL HA Sbjct: 25 LDMLAAEQGAGANTLDAYRRDLTDFSDYLGHA 56 >SED47063.1 tyrosine recombinase XerD subunit [Bradyrhizobium erythrophlei] Length = 335 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAG NTLDAYRRDLTDFSDYLAHA Sbjct: 33 LDMLAAEQGAGVNTLDAYRRDLTDFSDYLAHA 64 >WP_076864022.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. SEMIA 6399] Length = 326 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAG NTLDAYRRDLTDFSDYLAHA Sbjct: 25 LDMLAAEQGAGRNTLDAYRRDLTDFSDYLAHA 56 >WP_051346102.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. th.b2] Length = 335 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAG NTLDAYRRDLTDFSDYLAHA Sbjct: 33 LDMLAAEQGAGRNTLDAYRRDLTDFSDYLAHA 64 >ERF80028.1 tyrosine recombinase xerD [Bradyrhizobium sp. DFCI-1] Length = 337 Score = 64.7 bits (156), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAG+NTLDAYRRDLTDFSDYL HA Sbjct: 36 LDMLAAEQGAGSNTLDAYRRDLTDFSDYLGHA 67 >KIU49906.1 recombinase XerD [Bradyrhizobium elkanii] Length = 307 Score = 64.3 bits (155), Expect = 6e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSDYLA A Sbjct: 6 LDMLAAEQGAGANTLDAYRRDLTDFSDYLARA 37 >WP_050405943.1 site-specific tyrosine recombinase XerD [Bradyrhizobium embrapense] Length = 324 Score = 62.8 bits (151), Expect = 2e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAG NTLDAYRRDLTDFS YLAHA Sbjct: 22 LDMLAAEQGAGRNTLDAYRRDLTDFSGYLAHA 53 >WP_051389813.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. Ec3.3] Length = 337 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAH 6 LDMLAAEQGAG NTLDAYRRDLTDFSD+LAH Sbjct: 15 LDMLAAEQGAGPNTLDAYRRDLTDFSDFLAH 45 >WP_044536342.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. LTSP885] KJC51751.1 recombinase XerD [Bradyrhizobium sp. LTSP885] Length = 327 Score = 61.6 bits (148), Expect = 6e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFSD+LA + Sbjct: 23 LDMLAAEQGAGANTLDAYRRDLTDFSDFLARS 54 >WP_050630732.1 site-specific tyrosine recombinase XerD [Bradyrhizobium viridifuturi] Length = 300 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 92 MLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 MLAAEQGAG+NTLDAYRRDLTDFSDYL HA Sbjct: 1 MLAAEQGAGSNTLDAYRRDLTDFSDYLGHA 30 >WP_074132213.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. NAS96.2] OKO67455.1 recombinase XerD [Bradyrhizobium sp. NAS96.2] Length = 317 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAG NTLDAYRRDLTDFSDYL A Sbjct: 15 LDMLAAEQGAGLNTLDAYRRDLTDFSDYLTQA 46 >WP_029585080.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. URHD0069] Length = 318 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAGANTLDAYRRDLTDFS++LA A Sbjct: 15 LDMLAAEQGAGANTLDAYRRDLTDFSEFLASA 46 >WP_066509009.1 site-specific tyrosine recombinase XerD [Bradyrhizobium sp. BR 10303] KWV53100.1 recombinase XerD [Bradyrhizobium sp. BR 10303] Length = 325 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 98 LDMLAAEQGAGANTLDAYRRDLTDFSDYLAHA 3 LDMLAAEQGAG NTLDAYRRDLTDFS++LAH+ Sbjct: 23 LDMLAAEQGAGDNTLDAYRRDLTDFSEFLAHS 54