BLASTX nr result
ID: Glycyrrhiza29_contig00028520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00028520 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU11932.1 hypothetical protein TSUD_195560 [Trifolium subterran... 51 9e-06 >GAU11932.1 hypothetical protein TSUD_195560 [Trifolium subterraneum] Length = 463 Score = 51.2 bits (121), Expect = 9e-06 Identities = 25/45 (55%), Positives = 29/45 (64%) Frame = -2 Query: 145 MAKFMLRPDYNSCFFPQTHRTPLQSHSHTPFIKTPFPRFHFNLTP 11 M F L+P SCFF Q RT S+SH PFIKT F RF+F+ TP Sbjct: 1 MTIFTLKPHNKSCFFSQPQRTT--SYSHNPFIKTSFQRFNFHFTP 43