BLASTX nr result
ID: Glycyrrhiza29_contig00028494
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00028494 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012571109.1 PREDICTED: receptor-like serine/threonine-protein... 52 1e-05 >XP_012571109.1 PREDICTED: receptor-like serine/threonine-protein kinase SD1-6 isoform X2 [Cicer arietinum] Length = 424 Score = 52.0 bits (123), Expect = 1e-05 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = -1 Query: 275 DTVTLPSPTRPAFXXXXXXXXXXXXSNTSISVNEVTMSELRPR 147 D VTLP+PTRPAF SNTSISVNEVT+SE+RPR Sbjct: 382 DKVTLPNPTRPAFSVGRAVVDQVSSSNTSISVNEVTLSEVRPR 424