BLASTX nr result
ID: Glycyrrhiza29_contig00028377
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00028377 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO37060.1 hypothetical protein CISIN_1g037901mg, partial [Citru... 56 1e-07 ABI34627.1 bZIP transcription factor bZIP49, partial [Glycine max] 56 1e-07 OAY33967.1 hypothetical protein MANES_13G139500 [Manihot esculenta] 58 2e-07 OAY33966.1 hypothetical protein MANES_13G139500 [Manihot esculenta] 58 2e-07 XP_006469052.1 PREDICTED: basic leucine zipper 61 [Citrus sinensis] 56 8e-07 NP_001335877.1 bZIP transcription factor bZIP50 [Glycine max] KR... 56 1e-06 XP_017431608.1 PREDICTED: basic leucine zipper 61 isoform X3 [Vi... 55 1e-06 XP_017431607.1 PREDICTED: basic leucine zipper 61 isoform X2 [Vi... 55 1e-06 XP_017238170.1 PREDICTED: basic leucine zipper 34-like [Daucus c... 55 1e-06 XP_014524379.1 PREDICTED: basic leucine zipper 34-like [Vigna ra... 55 2e-06 XP_017431606.1 PREDICTED: basic leucine zipper 61 isoform X1 [Vi... 55 2e-06 XP_017248506.1 PREDICTED: basic leucine zipper 61-like [Daucus c... 55 2e-06 XP_004303124.1 PREDICTED: basic leucine zipper 34 [Fragaria vesc... 55 2e-06 XP_007132694.1 hypothetical protein PHAVU_011G116800g [Phaseolus... 55 3e-06 GAV75981.1 bZIP_2 domain-containing protein [Cephalotus follicul... 54 7e-06 XP_006446743.1 hypothetical protein CICLE_v10015966mg [Citrus cl... 54 7e-06 XP_014491711.1 PREDICTED: basic leucine zipper 61-like [Vigna ra... 53 1e-05 KHN41611.1 Putative transcription factor PosF21 [Glycine soja] 53 1e-05 XP_003539957.1 PREDICTED: basic leucine zipper 61 [Glycine max] ... 53 1e-05 ABI34644.1 bZIP transcription factor bZIP50 [Glycine max] 53 1e-05 >KDO37060.1 hypothetical protein CISIN_1g037901mg, partial [Citrus sinensis] Length = 119 Score = 56.2 bits (134), Expect = 1e-07 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTP WP F H K+PSS+ WVDEFL+F Sbjct: 1 MAQLPPKIPNMTPAWPDFF----HHKVPSSMANNNINNRSNVHNPSWVDEFLDF 50 >ABI34627.1 bZIP transcription factor bZIP49, partial [Glycine max] Length = 108 Score = 55.8 bits (133), Expect = 1e-07 Identities = 32/54 (59%), Positives = 33/54 (61%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTPNWP +FS S HQKMPS WVDEFL F Sbjct: 1 MAQLPPKIPNMTPNWP-DFS-SPHQKMPS------LKTMSPNQNPSWVDEFLEF 46 >OAY33967.1 hypothetical protein MANES_13G139500 [Manihot esculenta] Length = 318 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNM P WP SH + MP S+NK WVDEFL+F Sbjct: 1 MAQLPPKIPNMQPTWP---DFSHQKTMPPSINKAASPTAATGQNPSWVDEFLDF 51 >OAY33966.1 hypothetical protein MANES_13G139500 [Manihot esculenta] Length = 325 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNM P WP SH + MP S+NK WVDEFL+F Sbjct: 1 MAQLPPKIPNMQPTWP---DFSHQKTMPPSINKAASPTAATGQNPSWVDEFLDF 51 >XP_006469052.1 PREDICTED: basic leucine zipper 61 [Citrus sinensis] Length = 316 Score = 56.2 bits (134), Expect = 8e-07 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTP WP F H K+PSS+ WVDEFL+F Sbjct: 1 MAQLPPKIPNMTPAWPDFF----HHKVPSSMANNNINNRSNVHNPSWVDEFLDF 50 >NP_001335877.1 bZIP transcription factor bZIP50 [Glycine max] KRH55826.1 hypothetical protein GLYMA_06G284900 [Glycine max] Length = 340 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/54 (59%), Positives = 33/54 (61%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTPNWP +FS S HQKMPS WVDEFL F Sbjct: 1 MAQLPPKIPNMTPNWP-DFS-SPHQKMPS------LKTMSPNQNPSWVDEFLEF 46 >XP_017431608.1 PREDICTED: basic leucine zipper 61 isoform X3 [Vigna angularis] Length = 288 Score = 55.5 bits (132), Expect = 1e-06 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPK+PNMTPNWP +FS S HQKMPS WVDEFL+F Sbjct: 1 MAQLPPKVPNMTPNWP-DFS-SPHQKMPS---LKTMAPNVSNQNPSWVDEFLDF 49 >XP_017431607.1 PREDICTED: basic leucine zipper 61 isoform X2 [Vigna angularis] Length = 293 Score = 55.5 bits (132), Expect = 1e-06 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPK+PNMTPNWP +FS S HQKMPS WVDEFL+F Sbjct: 1 MAQLPPKVPNMTPNWP-DFS-SPHQKMPS---LKTMAPNVSNQNPSWVDEFLDF 49 >XP_017238170.1 PREDICTED: basic leucine zipper 34-like [Daucus carota subsp. sativus] KZN01011.1 hypothetical protein DCAR_009765 [Daucus carota subsp. sativus] Length = 317 Score = 55.5 bits (132), Expect = 1e-06 Identities = 30/73 (41%), Positives = 35/73 (47%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNFXXXXXX 329 MAQLPPK+PNM PN S SHHQK+PS N WVD++LNF Sbjct: 1 MAQLPPKVPNMAPNLAGLSSYSHHQKLPSMEN------LNSLQSHPWVDDYLNFSSSTKR 54 Query: 330 XXXXXXXVDSVTF 368 DS+ F Sbjct: 55 RSHRRSASDSIAF 67 >XP_014524379.1 PREDICTED: basic leucine zipper 34-like [Vigna radiata var. radiata] Length = 347 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPK+PNMTPNWP +FS S HQKMPS WVDEFL+F Sbjct: 1 MAQLPPKVPNMTPNWP-DFS-SPHQKMPSF---KTMAPNISNQNPSWVDEFLDF 49 >XP_017431606.1 PREDICTED: basic leucine zipper 61 isoform X1 [Vigna angularis] KOM50101.1 hypothetical protein LR48_Vigan08g092800 [Vigna angularis] BAT90046.1 hypothetical protein VIGAN_06121100 [Vigna angularis var. angularis] Length = 348 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPK+PNMTPNWP +FS S HQKMPS WVDEFL+F Sbjct: 1 MAQLPPKVPNMTPNWP-DFS-SPHQKMPS---LKTMAPNVSNQNPSWVDEFLDF 49 >XP_017248506.1 PREDICTED: basic leucine zipper 61-like [Daucus carota subsp. sativus] Length = 326 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/73 (41%), Positives = 34/73 (46%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNFXXXXXX 329 MAQLPPK+PNMTPNW SHHQ+MPS W DEFL+F Sbjct: 1 MAQLPPKVPNMTPNW---HDASHHQRMPS---MDSLGLAASNGGPSWADEFLDFSSTKRG 54 Query: 330 XXXXXXXVDSVTF 368 DS+ F Sbjct: 55 SHRRSVSTDSIAF 67 >XP_004303124.1 PREDICTED: basic leucine zipper 34 [Fragaria vesca subsp. vesca] XP_011466942.1 PREDICTED: basic leucine zipper 34 [Fragaria vesca subsp. vesca] Length = 329 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPK+PNMTPNWP +SHH KM S WVDEFL+F Sbjct: 1 MAQLPPKVPNMTPNWP---DLSHHHKMSSCF---AAPNGNAGSNPCWVDEFLDF 48 >XP_007132694.1 hypothetical protein PHAVU_011G116800g [Phaseolus vulgaris] XP_007132695.1 hypothetical protein PHAVU_011G116800g [Phaseolus vulgaris] ESW04688.1 hypothetical protein PHAVU_011G116800g [Phaseolus vulgaris] ESW04689.1 hypothetical protein PHAVU_011G116800g [Phaseolus vulgaris] Length = 329 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/54 (59%), Positives = 34/54 (62%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTPNW S+FS S HQKMPS WVDEFL+F Sbjct: 1 MAQLPPKIPNMTPNW-SDFS-SPHQKMPS---LKTMAPNMSNQNPSWVDEFLDF 49 >GAV75981.1 bZIP_2 domain-containing protein [Cephalotus follicularis] Length = 310 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/54 (57%), Positives = 33/54 (61%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTPNW SEFS HQK+PS WVDEFL+F Sbjct: 1 MAQLPPKIPNMTPNW-SEFS---HQKLPSM--TPIAAATMNTQNPSWVDEFLDF 48 >XP_006446743.1 hypothetical protein CICLE_v10015966mg [Citrus clementina] ESR59983.1 hypothetical protein CICLE_v10015966mg [Citrus clementina] Length = 318 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/54 (50%), Positives = 30/54 (55%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNM P WP F H K+PSS+ WVDEFL+F Sbjct: 1 MAQLPPKIPNMGPAWPDFF----HHKVPSSMANNNINNSSNVHNPSWVDEFLDF 50 >XP_014491711.1 PREDICTED: basic leucine zipper 61-like [Vigna radiata var. radiata] Length = 312 Score = 53.1 bits (126), Expect = 1e-05 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPN++P+WP +FS S HQKMP WVDEFL+F Sbjct: 1 MAQLPPKIPNLSPSWP-DFS-SQHQKMPLPPLNNDTAATHQNQNPSWVDEFLDF 52 >KHN41611.1 Putative transcription factor PosF21 [Glycine soja] Length = 327 Score = 53.1 bits (126), Expect = 1e-05 Identities = 31/54 (57%), Positives = 32/54 (59%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTPNWP +FS S HQKMPS WVDE L F Sbjct: 1 MAQLPPKIPNMTPNWP-DFS-SLHQKMPS------LQTTSSNQNPSWVDEILEF 46 >XP_003539957.1 PREDICTED: basic leucine zipper 61 [Glycine max] KRH25692.1 hypothetical protein GLYMA_12G121000 [Glycine max] Length = 330 Score = 53.1 bits (126), Expect = 1e-05 Identities = 31/54 (57%), Positives = 32/54 (59%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTPNWP +FS S HQKMPS WVDE L F Sbjct: 1 MAQLPPKIPNMTPNWP-DFS-SLHQKMPS------LQTTSSNQNPSWVDEILEF 46 >ABI34644.1 bZIP transcription factor bZIP50 [Glycine max] Length = 330 Score = 53.1 bits (126), Expect = 1e-05 Identities = 31/54 (57%), Positives = 32/54 (59%) Frame = +3 Query: 150 MAQLPPKIPNMTPNWPSEFSISHHQKMPSSLNKXXXXXXXXXXXXXWVDEFLNF 311 MAQLPPKIPNMTPNWP +FS S HQKMPS WVDE L F Sbjct: 1 MAQLPPKIPNMTPNWP-DFS-SLHQKMPS------LQTTSSNQNPSWVDEILEF 46