BLASTX nr result
ID: Glycyrrhiza29_contig00028311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00028311 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019438915.1 PREDICTED: putative FBD-associated F-box protein ... 45 1e-06 XP_013457041.1 FBD-associated F-box plant protein [Medicago trun... 40 7e-06 >XP_019438915.1 PREDICTED: putative FBD-associated F-box protein At1g61330 [Lupinus angustifolius] OIW13662.1 hypothetical protein TanjilG_08004 [Lupinus angustifolius] Length = 407 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Frame = -1 Query: 205 IRSPMLCSMFYCGVIPNRIVFAPGVALLEACFNF--TPNYIQASQVESLDNHFHSVRVLT 32 I +P L + YCG + +L EA F F + NY++ +E+L NH H+VRVLT Sbjct: 168 IDAPTLQHIHYCGFVVKLEFTQVVPSLSEAKFIFFRSRNYLKIPILENLVNHLHNVRVLT 227 Query: 31 TSVKFLEVYS 2 TS +F E S Sbjct: 228 TSAQFQEALS 237 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = -3 Query: 296 IRRVNILARTHMHFRMLKIACCFEVVGIEIDSIT 195 IRR++I A H +FR LKI C + IEID+ T Sbjct: 139 IRRISIFASEHKNFRTLKITTCPNLEKIEIDAPT 172 >XP_013457041.1 FBD-associated F-box plant protein [Medicago truncatula] KEH31072.1 FBD-associated F-box plant protein [Medicago truncatula] Length = 473 Score = 39.7 bits (91), Expect(2) = 7e-06 Identities = 28/67 (41%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -1 Query: 205 IRSPMLCSMFYCGVIPNRIVFAPGVALLEACFNFTPN--YIQASQVESLDNHFHSVRVLT 32 I SP L S+FY G + I G+ L EA F FTP+ YIQ S VE+L V +LT Sbjct: 233 IDSPTLHSIFYHGKF-STIRIVQGMQLYEAFFYFTPSKKYIQPSMVEALVKDLSHVSILT 291 Query: 31 TSVKFLE 11 + +E Sbjct: 292 ITPVIIE 298 Score = 37.4 bits (85), Expect(2) = 7e-06 Identities = 16/34 (47%), Positives = 26/34 (76%) Frame = -3 Query: 296 IRRVNILARTHMHFRMLKIACCFEVVGIEIDSIT 195 I+++N++AR + HF+ L+IA C ++ IEIDS T Sbjct: 204 IKKLNLIARENRHFKKLRIASCGDLKEIEIDSPT 237