BLASTX nr result
ID: Glycyrrhiza29_contig00028243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00028243 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU22806.1 hypothetical protein TSUD_142460, partial [Trifolium ... 57 7e-08 XP_004513037.1 PREDICTED: probable RNA-dependent RNA polymerase ... 55 5e-07 KVH93873.1 RNA-dependent RNA polymerase, eukaryotic-type, partia... 52 5e-06 KYP37196.1 putative RNA-dependent RNA polymerase 3 [Cajanus cajan] 51 8e-06 OAY27232.1 hypothetical protein MANES_16G110000 [Manihot esculenta] 51 8e-06 >GAU22806.1 hypothetical protein TSUD_142460, partial [Trifolium subterraneum] Length = 983 Score = 57.0 bits (136), Expect = 7e-08 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 122 VYRNPGMHFGDIHILHARYVEGLESYV 202 VYRNPG+HFGDIHI+ ARYVEGLESYV Sbjct: 648 VYRNPGLHFGDIHIMQARYVEGLESYV 674 >XP_004513037.1 PREDICTED: probable RNA-dependent RNA polymerase 5 [Cicer arietinum] Length = 997 Score = 54.7 bits (130), Expect = 5e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +2 Query: 122 VYRNPGMHFGDIHILHARYVEGLESYV 202 VYRNPG+HFGDIHI+ A YVEGLESYV Sbjct: 651 VYRNPGLHFGDIHIMQATYVEGLESYV 677 >KVH93873.1 RNA-dependent RNA polymerase, eukaryotic-type, partial [Cynara cardunculus var. scolymus] Length = 399 Score = 51.6 bits (122), Expect = 5e-06 Identities = 24/42 (57%), Positives = 28/42 (66%), Gaps = 10/42 (23%) Frame = +2 Query: 107 YWRCA----------VYRNPGMHFGDIHILHARYVEGLESYV 202 YW C+ VYRNPG+HFGDIHIL A+YVE LE +V Sbjct: 90 YWLCSENGQISGKVLVYRNPGLHFGDIHILTAKYVEELEGFV 131 >KYP37196.1 putative RNA-dependent RNA polymerase 3 [Cajanus cajan] Length = 957 Score = 51.2 bits (121), Expect = 8e-06 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +2 Query: 122 VYRNPGMHFGDIHILHARYVEGLESYV 202 VYRNPG+HFGDIH + ARYVE LESYV Sbjct: 603 VYRNPGLHFGDIHKMQARYVEELESYV 629 >OAY27232.1 hypothetical protein MANES_16G110000 [Manihot esculenta] Length = 1019 Score = 51.2 bits (121), Expect = 8e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 122 VYRNPGMHFGDIHILHARYVEGLESYV 202 VYRNPG+HFGDIHIL A YVEG+E +V Sbjct: 665 VYRNPGLHFGDIHILKATYVEGIEDFV 691