BLASTX nr result
ID: Glycyrrhiza29_contig00026987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00026987 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW17463.1 hypothetical protein TanjilG_22575 [Lupinus angustifo... 58 2e-07 XP_019422443.1 PREDICTED: nuclear pore complex protein DDB_G0274... 58 2e-07 KHN43369.1 Glucan endo-1,3-beta-glucosidase 1 [Glycine soja] 55 2e-06 XP_003553692.1 PREDICTED: glucan endo-1,3-beta-glucosidase 1-lik... 55 2e-06 KHN14216.1 Glucan endo-1,3-beta-glucosidase 1 [Glycine soja] 54 6e-06 >OIW17463.1 hypothetical protein TanjilG_22575 [Lupinus angustifolius] Length = 270 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/38 (68%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -1 Query: 304 FGSQSPP-DANISHSTGLRPFLGCMVLVISLVCGRLGI 194 FGSQSPP DA+ SHS GL+PF+GCMVL+ISLV G++ + Sbjct: 233 FGSQSPPPDADFSHSAGLKPFIGCMVLLISLVTGKISV 270 >XP_019422443.1 PREDICTED: nuclear pore complex protein DDB_G0274915-like [Lupinus angustifolius] Length = 337 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/38 (68%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -1 Query: 304 FGSQSPP-DANISHSTGLRPFLGCMVLVISLVCGRLGI 194 FGSQSPP DA+ SHS GL+PF+GCMVL+ISLV G++ + Sbjct: 300 FGSQSPPPDADFSHSAGLKPFIGCMVLLISLVTGKISV 337 >KHN43369.1 Glucan endo-1,3-beta-glucosidase 1 [Glycine soja] Length = 521 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 301 GSQSPPDANISHSTGLRPFLGCMVLVISLVCGRL 200 GSQSPPD N S+S LRPFLGCMVL ISLV RL Sbjct: 486 GSQSPPDLNTSYSASLRPFLGCMVLAISLVTARL 519 >XP_003553692.1 PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Glycine max] KRG96680.1 hypothetical protein GLYMA_19G225900 [Glycine max] Length = 529 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 301 GSQSPPDANISHSTGLRPFLGCMVLVISLVCGRL 200 GSQSPPD N S+S LRPFLGCMVL ISLV RL Sbjct: 494 GSQSPPDLNTSYSASLRPFLGCMVLAISLVTARL 527 >KHN14216.1 Glucan endo-1,3-beta-glucosidase 1 [Glycine soja] Length = 538 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 301 GSQSPPDANISHSTGLRPFLGCMVLVISLVCGRL 200 GSQSPPD N S+S GLRP LGCMVL ISLV RL Sbjct: 503 GSQSPPDLNTSYSAGLRPLLGCMVLAISLVTVRL 536