BLASTX nr result
ID: Glycyrrhiza29_contig00026784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00026784 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_007516853.1 hypothetical protein GlmaxMp03 (mitochondrion) [G... 128 5e-36 EYU25691.1 hypothetical protein MIMGU_mgv1a018587mg, partial [Er... 93 6e-23 KJB09734.1 hypothetical protein B456_001G161000, partial [Gossyp... 91 2e-20 YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] B... 66 5e-12 GAU48497.1 hypothetical protein TSUD_291830 [Trifolium subterran... 69 9e-12 NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris ... 56 3e-08 OMP10460.1 hypothetical protein COLO4_04489 [Corchorus olitorius... 50 1e-06 >YP_007516853.1 hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] AFR34334.1 hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] Length = 150 Score = 128 bits (321), Expect = 5e-36 Identities = 64/68 (94%), Positives = 64/68 (94%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHPFGHRDARTNPSNQPLFLENLPPARQDRATPK 180 DQTALHLVSPPSAYRSTRSM TRTELAHPFGHRDARTNPSNQPLFLENLPP DRATPK Sbjct: 78 DQTALHLVSPPSAYRSTRSMKTRTELAHPFGHRDARTNPSNQPLFLENLPP---DRATPK 134 Query: 181 SRIVQERS 204 SRIVQERS Sbjct: 135 SRIVQERS 142 >EYU25691.1 hypothetical protein MIMGU_mgv1a018587mg, partial [Erythranthe guttata] Length = 90 Score = 93.2 bits (230), Expect = 6e-23 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = +1 Query: 31 PSAYRSTRSMNTRTELAHPFGHRDARTNPSNQPLFLENLPPARQDRATPKSRIVQ 195 P AYR TRSM T+TELAHPFGHRDARTNP+NQP FL NLPPARQDR TP++ V+ Sbjct: 15 PGAYRFTRSMKTQTELAHPFGHRDARTNPNNQPFFLSNLPPARQDRGTPEASRVR 69 >KJB09734.1 hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 90.9 bits (224), Expect = 2e-20 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHPFGHRDARTNPSNQPLF 135 DQTALHLVSPP AYRS RSMNTRTELAHPFGHR ARTNPSNQPLF Sbjct: 21 DQTALHLVSPPEAYRSARSMNTRTELAHPFGHRGARTNPSNQPLF 65 >YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] BAD83543.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 66.2 bits (160), Expect = 5e-12 Identities = 36/52 (69%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = +1 Query: 58 MNTRTELAHPFGHRDARTNPSNQPLFLENL---PPARQDRATPKSRIVQERS 204 MNT+TELAHPFGHRDARTNPSNQPLF E+ PP Q RIVQERS Sbjct: 1 MNTQTELAHPFGHRDARTNPSNQPLFFESASSKPP--QPYRQKAVRIVQERS 50 >GAU48497.1 hypothetical protein TSUD_291830 [Trifolium subterraneum] Length = 481 Score = 69.3 bits (168), Expect = 9e-12 Identities = 39/61 (63%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = -2 Query: 206 CERSCTIRLFGVALS--CLAGGRFXXXXXXXXXXXXXXLCPKGWASSVRVFIDRVDLYAE 33 CERSCTIRLFGVALS CLAG KGWASSVRVFIDRVDLYAE Sbjct: 37 CERSCTIRLFGVALSLSCLAGVEADFLKKRLIRFSRPYAQKKGWASSVRVFIDRVDLYAE 96 Query: 32 G 30 G Sbjct: 97 G 97 >NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222346.1 hypothetical protein BevumaM_p112 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842151.1 hypothetical protein BemaM_p107 (mitochondrion) [Beta macrocarpa] BAA99498.1 orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14076.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17566.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20714.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24956.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL51962.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 56.2 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHPF 90 DQTALHLVSP AYRSTRS+ TRTELAHPF Sbjct: 11 DQTALHLVSPSEAYRSTRSIKTRTELAHPF 40 >OMP10460.1 hypothetical protein COLO4_04489 [Corchorus olitorius] OMP10520.1 hypothetical protein COLO4_04462 [Corchorus olitorius] OMP10559.1 hypothetical protein COLO4_04436 [Corchorus olitorius] Length = 48 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHP 87 DQTALHLVSP AYRS RSM T++ELAHP Sbjct: 11 DQTALHLVSPSEAYRSARSMKTQSELAHP 39