BLASTX nr result
ID: Glycyrrhiza29_contig00026641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00026641 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47673.1 hypothetical protein TSUD_380270 [Trifolium subterran... 54 2e-07 XP_013462864.1 peroxisomal membrane 22 kDa (Mpv17/PMP22) family ... 53 1e-06 XP_015959066.1 PREDICTED: peroxisomal membrane protein PMP22 [Ar... 52 3e-06 XP_012572013.1 PREDICTED: peroxisomal membrane protein PMP22 [Ci... 51 6e-06 KHN40875.1 Peroxisomal membrane protein PMP22 [Glycine soja] 49 9e-06 >GAU47673.1 hypothetical protein TSUD_380270 [Trifolium subterraneum] Length = 151 Score = 54.3 bits (129), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 110 LKESLLAVQVITAGVLSGISDIVSQKLTGIQKLQF 214 L+E L +VITAGVLSGISDIVSQKLTGIQK+QF Sbjct: 16 LQEHPLRTKVITAGVLSGISDIVSQKLTGIQKIQF 50 >XP_013462864.1 peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago truncatula] AFK42482.1 unknown [Medicago truncatula] KEH36899.1 peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago truncatula] Length = 185 Score = 52.8 bits (125), Expect = 1e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 110 LKESLLAVQVITAGVLSGISDIVSQKLTGIQKLQ 211 L+E L +VITAGVLSGISDIVSQKLTGIQKLQ Sbjct: 16 LQEHPLRTKVITAGVLSGISDIVSQKLTGIQKLQ 49 >XP_015959066.1 PREDICTED: peroxisomal membrane protein PMP22 [Arachis duranensis] XP_016197476.1 PREDICTED: peroxisomal membrane protein PMP22 [Arachis ipaensis] Length = 185 Score = 51.6 bits (122), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 110 LKESLLAVQVITAGVLSGISDIVSQKLTGIQKLQF 214 L++ L +VITAGVLS ISDIVSQKLTGIQKLQF Sbjct: 16 LQQHPLRTKVITAGVLSAISDIVSQKLTGIQKLQF 50 >XP_012572013.1 PREDICTED: peroxisomal membrane protein PMP22 [Cicer arietinum] Length = 185 Score = 50.8 bits (120), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 110 LKESLLAVQVITAGVLSGISDIVSQKLTGIQKLQF 214 L++ L + ITAGVLSGISDIVSQKLTGI+KLQF Sbjct: 16 LQQHPLRTKAITAGVLSGISDIVSQKLTGIRKLQF 50 >KHN40875.1 Peroxisomal membrane protein PMP22 [Glycine soja] Length = 87 Score = 48.5 bits (114), Expect = 9e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 110 LKESLLAVQVITAGVLSGISDIVSQKLTGIQKLQ 211 L++ L ++VI AGVLS ISDIVSQKLTGIQKLQ Sbjct: 5 LQQHPLRIKVIAAGVLSAISDIVSQKLTGIQKLQ 38