BLASTX nr result
ID: Glycyrrhiza29_contig00026311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00026311 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW04899.1 hypothetical protein TanjilG_23902 [Lupinus angustifo... 81 7e-18 >OIW04899.1 hypothetical protein TanjilG_23902 [Lupinus angustifolius] Length = 119 Score = 80.9 bits (198), Expect = 7e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 260 VEANEREKRSTTRAEAE*KIALLFYDSAVKEAHFTISLGMGKI 132 VEANEREKRSTTRAEAE KIAL+FYDSAVKEAHFTISLGMGKI Sbjct: 76 VEANEREKRSTTRAEAEYKIALIFYDSAVKEAHFTISLGMGKI 118