BLASTX nr result
ID: Glycyrrhiza29_contig00026292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00026292 (222 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003615753.2 fructose-6-phosphate-2-kinase/fructose-2, 6-bisph... 54 4e-13 XP_007142185.1 hypothetical protein PHAVU_008G259400g [Phaseolus... 55 1e-12 XP_004490623.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 54 2e-12 XP_003544892.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 55 5e-12 XP_003519259.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 55 5e-12 XP_014624761.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 55 5e-12 XP_006596432.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 55 5e-12 KRH17066.1 hypothetical protein GLYMA_14G195700 [Glycine max] 55 5e-12 BAT81507.1 hypothetical protein VIGAN_03124300 [Vigna angularis ... 55 7e-12 BAT81509.1 hypothetical protein VIGAN_03124600 [Vigna angularis ... 55 7e-12 XP_017428638.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 55 7e-12 XP_019437100.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 54 1e-11 XP_019437101.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 54 1e-11 XP_019437102.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 54 1e-11 OIW15503.1 hypothetical protein TanjilG_32907 [Lupinus angustifo... 54 1e-11 XP_016166419.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 53 2e-11 XP_015932014.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 53 2e-11 KDO66949.1 hypothetical protein CISIN_1g004453mg [Citrus sinensis] 53 2e-11 XP_006425106.1 hypothetical protein CICLE_v10027872mg [Citrus cl... 53 2e-11 XP_014504886.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-... 54 2e-11 >XP_003615753.2 fructose-6-phosphate-2-kinase/fructose-2, 6-bisphosphatase [Medicago truncatula] AES98711.2 fructose-6-phosphate-2-kinase/fructose-2, 6-bisphosphatase [Medicago truncatula] Length = 744 Score = 53.9 bits (128), Expect(2) = 4e-13 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVD+IERNIRFKIQQSPDY E Sbjct: 457 ETICNDVDMIERNIRFKIQQSPDYAE 482 Score = 47.8 bits (112), Expect(2) = 4e-13 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGLRDFKTRVANYEKVY Sbjct: 484 PDFEAGLRDFKTRVANYEKVY 504 >XP_007142185.1 hypothetical protein PHAVU_008G259400g [Phaseolus vulgaris] ESW14179.1 hypothetical protein PHAVU_008G259400g [Phaseolus vulgaris] Length = 733 Score = 54.7 bits (130), Expect(2) = 1e-12 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVD+IERNIRFKIQQSPDY E Sbjct: 446 ETICNDVDVIERNIRFKIQQSPDYAE 471 Score = 45.4 bits (106), Expect(2) = 1e-12 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGLRDFK RVANYEKVY Sbjct: 473 PDFEAGLRDFKERVANYEKVY 493 >XP_004490623.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase [Cicer arietinum] Length = 742 Score = 53.9 bits (128), Expect(2) = 2e-12 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVD+IERNIRFKIQQSPDY E Sbjct: 455 ETICNDVDMIERNIRFKIQQSPDYAE 480 Score = 45.4 bits (106), Expect(2) = 2e-12 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGLRDFK RVANYEKVY Sbjct: 482 PDFEAGLRDFKIRVANYEKVY 502 >XP_003544892.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like isoform X1 [Glycine max] KRH17065.1 hypothetical protein GLYMA_14G195700 [Glycine max] Length = 741 Score = 55.1 bits (131), Expect(2) = 5e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 454 ETICNDVDIIERNIRFKIQQSPDYAE 479 Score = 42.7 bits (99), Expect(2) = 5e-12 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 162 DFEAGLRDFKTRVANYEKVY 221 DFEAGLRDFK RVANYEKVY Sbjct: 482 DFEAGLRDFKERVANYEKVY 501 >XP_003519259.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like isoform X1 [Glycine max] KRH72714.1 hypothetical protein GLYMA_02G228700 [Glycine max] Length = 740 Score = 55.1 bits (131), Expect(2) = 5e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 453 ETICNDVDIIERNIRFKIQQSPDYAE 478 Score = 42.7 bits (99), Expect(2) = 5e-12 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 162 DFEAGLRDFKTRVANYEKVY 221 DFEAGLRDFK RVANYEKVY Sbjct: 481 DFEAGLRDFKERVANYEKVY 500 >XP_014624761.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like isoform X2 [Glycine max] Length = 727 Score = 55.1 bits (131), Expect(2) = 5e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 440 ETICNDVDIIERNIRFKIQQSPDYAE 465 Score = 42.7 bits (99), Expect(2) = 5e-12 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 162 DFEAGLRDFKTRVANYEKVY 221 DFEAGLRDFK RVANYEKVY Sbjct: 468 DFEAGLRDFKERVANYEKVY 487 >XP_006596432.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like isoform X2 [Glycine max] Length = 725 Score = 55.1 bits (131), Expect(2) = 5e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 454 ETICNDVDIIERNIRFKIQQSPDYAE 479 Score = 42.7 bits (99), Expect(2) = 5e-12 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 162 DFEAGLRDFKTRVANYEKVY 221 DFEAGLRDFK RVANYEKVY Sbjct: 482 DFEAGLRDFKERVANYEKVY 501 >KRH17066.1 hypothetical protein GLYMA_14G195700 [Glycine max] Length = 533 Score = 55.1 bits (131), Expect(2) = 5e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 246 ETICNDVDIIERNIRFKIQQSPDYAE 271 Score = 42.7 bits (99), Expect(2) = 5e-12 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 162 DFEAGLRDFKTRVANYEKVY 221 DFEAGLRDFK RVANYEKVY Sbjct: 274 DFEAGLRDFKERVANYEKVY 293 >BAT81507.1 hypothetical protein VIGAN_03124300 [Vigna angularis var. angularis] Length = 742 Score = 55.1 bits (131), Expect(2) = 7e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 455 ETICNDVDIIERNIRFKIQQSPDYAE 480 Score = 42.4 bits (98), Expect(2) = 7e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGLRDFK RVA YEKVY Sbjct: 482 PDFEAGLRDFKERVAYYEKVY 502 >BAT81509.1 hypothetical protein VIGAN_03124600 [Vigna angularis var. angularis] Length = 509 Score = 55.1 bits (131), Expect(2) = 7e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 226 ETICNDVDIIERNIRFKIQQSPDYAE 251 Score = 42.4 bits (98), Expect(2) = 7e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGLRDFK RVA YEKVY Sbjct: 253 PDFEAGLRDFKERVAYYEKVY 273 >XP_017428638.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like [Vigna angularis] Length = 369 Score = 55.1 bits (131), Expect(2) = 7e-12 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIRFKIQQSPDY E Sbjct: 82 ETICNDVDIIERNIRFKIQQSPDYAE 107 Score = 42.4 bits (98), Expect(2) = 7e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGLRDFK RVA YEKVY Sbjct: 109 PDFEAGLRDFKERVAYYEKVY 129 >XP_019437100.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase isoform X1 [Lupinus angustifolius] Length = 746 Score = 53.5 bits (127), Expect(2) = 1e-11 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEEE*SF 91 ETICNDV+IIERNIR KIQQSPDY EE F Sbjct: 454 ETICNDVNIIERNIRLKIQQSPDYAEEPDF 483 Score = 42.7 bits (99), Expect(2) = 1e-11 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGL+DFK R+ANYEKVY Sbjct: 481 PDFEAGLQDFKIRLANYEKVY 501 >XP_019437101.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase isoform X2 [Lupinus angustifolius] Length = 745 Score = 53.5 bits (127), Expect(2) = 1e-11 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEEE*SF 91 ETICNDV+IIERNIR KIQQSPDY EE F Sbjct: 453 ETICNDVNIIERNIRLKIQQSPDYAEEPDF 482 Score = 42.7 bits (99), Expect(2) = 1e-11 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGL+DFK R+ANYEKVY Sbjct: 480 PDFEAGLQDFKIRLANYEKVY 500 >XP_019437102.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase isoform X3 [Lupinus angustifolius] Length = 741 Score = 53.5 bits (127), Expect(2) = 1e-11 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEEE*SF 91 ETICNDV+IIERNIR KIQQSPDY EE F Sbjct: 454 ETICNDVNIIERNIRLKIQQSPDYAEEPDF 483 Score = 42.7 bits (99), Expect(2) = 1e-11 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGL+DFK R+ANYEKVY Sbjct: 481 PDFEAGLQDFKIRLANYEKVY 501 >OIW15503.1 hypothetical protein TanjilG_32907 [Lupinus angustifolius] Length = 678 Score = 53.5 bits (127), Expect(2) = 1e-11 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEEE*SF 91 ETICNDV+IIERNIR KIQQSPDY EE F Sbjct: 484 ETICNDVNIIERNIRLKIQQSPDYAEEPDF 513 Score = 42.7 bits (99), Expect(2) = 1e-11 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGL+DFK R+ANYEKVY Sbjct: 511 PDFEAGLQDFKIRLANYEKVY 531 >XP_016166419.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like isoform X1 [Arachis ipaensis] Length = 763 Score = 52.8 bits (125), Expect(2) = 2e-11 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIR KIQQSPDY E Sbjct: 476 ETICNDVDIIERNIRLKIQQSPDYAE 501 Score = 43.1 bits (100), Expect(2) = 2e-11 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 162 DFEAGLRDFKTRVANYEKVY 221 DFEAGLRDFK RVANYEKVY Sbjct: 504 DFEAGLRDFKNRVANYEKVY 523 >XP_015932014.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase isoform X1 [Arachis duranensis] Length = 760 Score = 52.8 bits (125), Expect(2) = 2e-11 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDVDIIERNIR KIQQSPDY E Sbjct: 473 ETICNDVDIIERNIRLKIQQSPDYAE 498 Score = 43.1 bits (100), Expect(2) = 2e-11 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 162 DFEAGLRDFKTRVANYEKVY 221 DFEAGLRDFK RVANYEKVY Sbjct: 501 DFEAGLRDFKNRVANYEKVY 520 >KDO66949.1 hypothetical protein CISIN_1g004453mg [Citrus sinensis] Length = 753 Score = 52.8 bits (125), Expect(2) = 2e-11 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEEE*SF 91 ETICND DIIERNIR KIQQSPDY EE F Sbjct: 466 ETICNDRDIIERNIRLKIQQSPDYAEEPDF 495 Score = 43.1 bits (100), Expect(2) = 2e-11 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGL+DFK R+ANYEKVY Sbjct: 493 PDFEAGLQDFKNRLANYEKVY 513 >XP_006425106.1 hypothetical protein CICLE_v10027872mg [Citrus clementina] ESR38346.1 hypothetical protein CICLE_v10027872mg [Citrus clementina] Length = 753 Score = 52.8 bits (125), Expect(2) = 2e-11 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEEE*SF 91 ETICND DIIERNIR KIQQSPDY EE F Sbjct: 466 ETICNDRDIIERNIRLKIQQSPDYAEEPDF 495 Score = 43.1 bits (100), Expect(2) = 2e-11 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGL+DFK R+ANYEKVY Sbjct: 493 PDFEAGLQDFKNRLANYEKVY 513 >XP_014504886.1 PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase [Vigna radiata var. radiata] Length = 742 Score = 53.5 bits (127), Expect(2) = 2e-11 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 2 ETICNDVDIIERNIRFKIQQSPDYEE 79 ETICNDV+IIERNIRFKIQQSPDY E Sbjct: 455 ETICNDVEIIERNIRFKIQQSPDYAE 480 Score = 42.4 bits (98), Expect(2) = 2e-11 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 159 PDFEAGLRDFKTRVANYEKVY 221 PDFEAGLRDFK RVA YEKVY Sbjct: 482 PDFEAGLRDFKERVAYYEKVY 502