BLASTX nr result
ID: Glycyrrhiza29_contig00026160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00026160 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP66449.1 Ankyrin repeat-containing protein At3g12360 family [C... 55 3e-06 >KYP66449.1 Ankyrin repeat-containing protein At3g12360 family [Cajanus cajan] Length = 770 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 5/69 (7%) Frame = -1 Query: 194 PIKLLGRLLRGI-----AYLFIQIFKCLSIFGVKDTYDRKLIHYEVLGILNCFCQSIKNF 30 P+KLLGRLL + Y+ +++ L I G+++ Y++K H VL IL C CQ +K + Sbjct: 403 PVKLLGRLLIFVYLLFQTYILLKLSDELIISGIREIYEQKKTHCLVLEILKCLCQRVKEY 462 Query: 29 NRLQLQQAS 3 QLQ+AS Sbjct: 463 KESQLQEAS 471