BLASTX nr result
ID: Glycyrrhiza29_contig00026016
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00026016 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007153117.1 hypothetical protein PHAVU_003G008100g [Phaseolus... 53 7e-06 >XP_007153117.1 hypothetical protein PHAVU_003G008100g [Phaseolus vulgaris] ESW25111.1 hypothetical protein PHAVU_003G008100g [Phaseolus vulgaris] Length = 526 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = +2 Query: 191 TPFLGIREENPSQIITHHQXXXXXXXXXXXXXXVPQKKRRNQPGTP 328 TPFLGIR+EN +Q+ HQ VPQKKRRNQPGTP Sbjct: 8 TPFLGIRQENQTQVSQQHQSSTAASSTTTSTTTVPQKKRRNQPGTP 53