BLASTX nr result
ID: Glycyrrhiza29_contig00025659
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00025659 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004517198.1 PREDICTED: pentatricopeptide repeat-containing pr... 156 1e-42 XP_013466859.1 PPR containing plant protein [Medicago truncatula... 130 4e-33 XP_016175627.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 8e-33 XP_006430611.1 hypothetical protein CICLE_v10011485mg [Citrus cl... 125 3e-31 GAV76712.1 PPR domain-containing protein/PPR_2 domain-containing... 124 4e-31 XP_019426560.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 9e-31 XP_006482125.1 PREDICTED: pentatricopeptide repeat-containing pr... 123 1e-30 XP_015939464.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 3e-30 XP_015880282.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 5e-30 XP_015880277.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 5e-30 XP_004301459.1 PREDICTED: pentatricopeptide repeat-containing pr... 121 9e-30 XP_015582090.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 5e-29 XP_008385788.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 6e-29 EEF31203.1 pentatricopeptide repeat-containing protein, putative... 119 7e-29 XP_010274732.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 1e-28 ONK66233.1 uncharacterized protein A4U43_C06F5600 [Asparagus off... 117 2e-28 CAN82481.1 hypothetical protein VITISV_012747 [Vitis vinifera] 117 2e-28 XP_002305195.1 pentatricopeptide repeat-containing family protei... 117 3e-28 XP_003633738.2 PREDICTED: pentatricopeptide repeat-containing pr... 116 5e-28 XP_011002790.1 PREDICTED: pentatricopeptide repeat-containing pr... 116 5e-28 >XP_004517198.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570087.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570098.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012567888.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] Length = 551 Score = 156 bits (394), Expect = 1e-42 Identities = 75/122 (61%), Positives = 95/122 (77%) Frame = +3 Query: 9 KSHSQTAFRSTSKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKD 188 K HS+T+F ST K NIV+ +C+SFR +NWD ++ +F S++L+ SLVEQVLLELK Sbjct: 18 KLHSETSFNSTPKHTTTTNIVTLLCNSFRMKQNWDTLTHKFSSIKLNHSLVEQVLLELKH 77 Query: 189 PIDAKTALGFFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDSPAV 368 P DAK AL FFHW +KTH F+HG+RSYSI IH+LL+AGL+TDA ALLESL NK+T + V Sbjct: 78 PTDAKNALSFFHWSSKTHSFQHGLRSYSITIHLLLQAGLITDANALLESLVNKHTKTHTV 137 Query: 369 RA 374 RA Sbjct: 138 RA 139 >XP_013466859.1 PPR containing plant protein [Medicago truncatula] KEH40900.1 PPR containing plant protein [Medicago truncatula] Length = 547 Score = 130 bits (327), Expect = 4e-33 Identities = 63/122 (51%), Positives = 87/122 (71%) Frame = +3 Query: 9 KSHSQTAFRSTSKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKD 188 K HS + + + N NI+++I +SFR +NWD ++ +F S++L+ SL EQ+LL L + Sbjct: 19 KLHSHSHTTTFNNSSNNNNIITSISNSFRTKQNWDTITHKFTSIKLTPSLAEQILLNLNN 78 Query: 189 PIDAKTALGFFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDSPAV 368 P DAK AL FFHW KTHRF+H + SYSI I++LL + L+TDAKALLES+A KNT + V Sbjct: 79 PTDAKNALSFFHWSTKTHRFQHTLHSYSITINLLLHSNLLTDAKALLESIALKNTQTHTV 138 Query: 369 RA 374 RA Sbjct: 139 RA 140 >XP_016175627.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175628.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175629.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175630.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175631.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175633.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175634.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] Length = 547 Score = 129 bits (325), Expect = 8e-33 Identities = 62/101 (61%), Positives = 78/101 (77%) Frame = +3 Query: 57 NINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAK 236 N + V+AIC+SFRRG NWD +S +FG+ L+D +VE+VLLELKDP DAK ALGFFHW K Sbjct: 40 NNDDVTAICNSFRRGWNWDTISIKFGTFMLNDWMVERVLLELKDPSDAKCALGFFHWSTK 99 Query: 237 THRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDS 359 +HG+R Y IAIH+L+RA L+ DA+ALLESL NK +S Sbjct: 100 RRNIEHGIRCYCIAIHILVRARLLNDARALLESLLNKTKES 140 >XP_006430611.1 hypothetical protein CICLE_v10011485mg [Citrus clementina] ESR43851.1 hypothetical protein CICLE_v10011485mg [Citrus clementina] Length = 521 Score = 125 bits (313), Expect = 3e-31 Identities = 60/105 (57%), Positives = 80/105 (76%) Frame = +3 Query: 36 STSKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALG 215 ST K N ++V+AICD FRRG NWD +S +F S+ L+DSLVE VLLELK+P+DAK ALG Sbjct: 30 STRKPKSN-SLVTAICDCFRRGWNWDTLSKQFNSIHLNDSLVENVLLELKEPVDAKRALG 88 Query: 216 FFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKN 350 FFHW A ++H + SYS+ IH+L+RA L+ DA+AL+ES+ K+ Sbjct: 89 FFHWSAHHKSYQHNLCSYSVTIHILVRARLLVDARALIESVLEKH 133 >GAV76712.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 524 Score = 124 bits (312), Expect = 4e-31 Identities = 61/101 (60%), Positives = 78/101 (77%) Frame = +3 Query: 48 QDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHW 227 + N IV+ ICDS RRG NW+ +S +F SVEL++SLV+ VLLELK+P DAK ALGFFHW Sbjct: 40 EPNNNTIVNGICDSLRRGWNWETLSRKFDSVELNESLVKTVLLELKEPTDAKCALGFFHW 99 Query: 228 FAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKN 350 A+ F+HG+ SYS+AIH+L+RA L DAKALLES+ K+ Sbjct: 100 SAQRKGFEHGLWSYSLAIHILVRARLFMDAKALLESILKKS 140 >XP_019426560.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Lupinus angustifolius] OIV90410.1 hypothetical protein TanjilG_00054 [Lupinus angustifolius] Length = 535 Score = 124 bits (310), Expect = 9e-31 Identities = 59/97 (60%), Positives = 75/97 (77%) Frame = +3 Query: 69 VSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAKTHRF 248 VSA+C+SFR+G NWD ++ +FGS +LSDS+VEQVLLE ++P DAK AL FFHW K F Sbjct: 33 VSAVCNSFRKGWNWDIITNKFGSFKLSDSVVEQVLLEFRNPSDAKNALSFFHWSTKNMGF 92 Query: 249 KHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDS 359 KHG SY IH+L+RA LVTDA+AL+ES+ KN +S Sbjct: 93 KHGTWSYCAVIHILVRARLVTDARALVESVLLKNKES 129 >XP_006482125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Citrus sinensis] Length = 553 Score = 123 bits (309), Expect = 1e-30 Identities = 59/105 (56%), Positives = 80/105 (76%) Frame = +3 Query: 36 STSKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALG 215 ST K N ++V+AICD FRRG NWD +S +F S+ L+DSLVE VLLELK+P+DAK ALG Sbjct: 30 STRKPKSN-SLVTAICDCFRRGWNWDTLSKQFNSIHLNDSLVENVLLELKEPVDAKRALG 88 Query: 216 FFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKN 350 FFHW A ++H + SYS+ IH+L++A L+ DA+AL+ES+ K+ Sbjct: 89 FFHWSAHHKSYQHNLCSYSVTIHILVQARLLVDARALIESVLEKH 133 >XP_015939464.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939465.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939466.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939467.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939468.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939469.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939470.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939472.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939473.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] Length = 547 Score = 122 bits (307), Expect = 3e-30 Identities = 60/101 (59%), Positives = 75/101 (74%) Frame = +3 Query: 57 NINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAK 236 N + V+AIC+SFRRG NWD +S +FG+ L+ +VE+VLLELKDP DAK ALGFFHW K Sbjct: 40 NNDDVTAICNSFRRGWNWDTISIKFGTFMLNHLMVERVLLELKDPSDAKCALGFFHWSTK 99 Query: 237 THRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDS 359 +HG+R Y IAIH+L+ A L+ DA ALLESL NK +S Sbjct: 100 RRNIEHGIRCYCIAIHILVGARLLNDACALLESLLNKTKES 140 >XP_015880282.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Ziziphus jujuba] Length = 551 Score = 122 bits (305), Expect = 5e-30 Identities = 62/115 (53%), Positives = 82/115 (71%) Frame = +3 Query: 15 HSQTAFRSTSKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPI 194 H Q T+ D +V AIC S R GRNWD +S +FGSV+L + +V++VLLELK+P+ Sbjct: 22 HLQLIHTETAAND----VVKAICCSLRAGRNWDILSRKFGSVDLDEVVVKKVLLELKEPV 77 Query: 195 DAKTALGFFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDS 359 DAK ALGFFHW A + +HG++SY I IH+L+RAGL DA+ALLES+ KN+ S Sbjct: 78 DAKRALGFFHWSAHSTFQQHGLQSYCILIHILVRAGLNLDARALLESVLKKNSGS 132 >XP_015880277.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Ziziphus jujuba] Length = 551 Score = 122 bits (305), Expect = 5e-30 Identities = 62/115 (53%), Positives = 82/115 (71%) Frame = +3 Query: 15 HSQTAFRSTSKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPI 194 H Q T+ D +V AIC S R GRNWD +S +FGSV+L + +V++VLLELK+P+ Sbjct: 22 HLQLIHTETATND----VVKAICCSLRAGRNWDILSRKFGSVDLDEVVVKKVLLELKEPV 77 Query: 195 DAKTALGFFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDS 359 DAK ALGFFHW A + +HG++SY I IH+L+RAGL DA+ALLES+ KN+ S Sbjct: 78 DAKRALGFFHWSAHSTFQQHGLQSYCILIHILVRAGLNLDARALLESVLKKNSGS 132 >XP_004301459.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Fragaria vesca subsp. vesca] Length = 530 Score = 121 bits (303), Expect = 9e-30 Identities = 58/96 (60%), Positives = 72/96 (75%) Frame = +3 Query: 63 NIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAKTH 242 N+V AICDSF+ G +WDA++ +F V+L LVE VLLELKDP DAK ALGFFHW +K Sbjct: 30 NVVRAICDSFKSGWSWDALTSKFACVKLDAKLVENVLLELKDPNDAKRALGFFHWVSKRK 89 Query: 243 RFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKN 350 F HGV SYSI IH+L+RA + DA+AL+ES+ KN Sbjct: 90 DFDHGVWSYSITIHILVRAKMAMDARALMESVLKKN 125 >XP_015582090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582093.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582097.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] Length = 557 Score = 119 bits (298), Expect = 5e-29 Identities = 61/105 (58%), Positives = 79/105 (75%) Frame = +3 Query: 42 SKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFF 221 +K DG+ IV AICDS RRG NW ++S +F VEL+ LVE+VLLELK+PIDAK ALGFF Sbjct: 39 AKPDGDA-IVYAICDSLRRGHNWVSLSGKFQYVELNHLLVEKVLLELKEPIDAKRALGFF 97 Query: 222 HWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTD 356 HW A+ F HGV SY + +++L+RA L+ DA+ALLES+ KN + Sbjct: 98 HWSAQRKNFVHGVWSYCLMVNILVRAQLLNDAQALLESILKKNVE 142 >XP_008385788.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Malus domestica] Length = 534 Score = 119 bits (297), Expect = 6e-29 Identities = 59/101 (58%), Positives = 74/101 (73%) Frame = +3 Query: 63 NIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAKTH 242 ++V +I DSFR NWD +S +F SV+L LVE VLL LK+PIDAK ALGFFHW A + Sbjct: 33 DVVKSIRDSFRSSCNWDTLSTKFESVKLDGELVESVLLALKEPIDAKRALGFFHWAAHSK 92 Query: 243 RFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDSPA 365 F+HGV SYSI IH+L RA L+ DA+ALLES+ KN +P+ Sbjct: 93 DFEHGVWSYSITIHILARARLLMDARALLESVLKKNVGNPS 133 >EEF31203.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 119 bits (298), Expect = 7e-29 Identities = 61/105 (58%), Positives = 79/105 (75%) Frame = +3 Query: 42 SKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFF 221 +K DG+ IV AICDS RRG NW ++S +F VEL+ LVE+VLLELK+PIDAK ALGFF Sbjct: 39 AKPDGDA-IVYAICDSLRRGHNWVSLSGKFQYVELNHLLVEKVLLELKEPIDAKRALGFF 97 Query: 222 HWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTD 356 HW A+ F HGV SY + +++L+RA L+ DA+ALLES+ KN + Sbjct: 98 HWSAQRKNFVHGVWSYCLMVNILVRAQLLNDAQALLESILKKNVE 142 >XP_010274732.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Nelumbo nucifera] Length = 578 Score = 118 bits (296), Expect = 1e-28 Identities = 51/108 (47%), Positives = 79/108 (73%) Frame = +3 Query: 27 AFRSTSKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKT 206 A + ++ + ++ +CDS RRG NWD +S F S++L+DS+VE++LLELK+P DA+ Sbjct: 34 AIHTGKEESKSGEVIDRVCDSLRRGGNWDTLSGNFDSIKLTDSVVEKILLELKEPADARR 93 Query: 207 ALGFFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKN 350 AL FFHW A+ F+HG+RSY +A+ +L+RA ++ DA+ALLES+ K+ Sbjct: 94 ALSFFHWSARRKSFQHGIRSYCVAVQILVRARMLNDARALLESVIRKS 141 >ONK66233.1 uncharacterized protein A4U43_C06F5600 [Asparagus officinalis] Length = 568 Score = 117 bits (294), Expect = 2e-28 Identities = 57/122 (46%), Positives = 86/122 (70%), Gaps = 3/122 (2%) Frame = +3 Query: 3 SRKSHSQTAFRST---SKQDGNINIVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVL 173 S K +S RS+ +KQ + + V+ +C+ +G NWD ++ +F S++L+++LVE+VL Sbjct: 18 SLKPYSSFNLRSSQTLAKQPNSSDFVAPVCNLLAQGANWDTLTSKFPSIQLTETLVEKVL 77 Query: 174 LELKDPIDAKTALGFFHWFAKTHRFKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNT 353 L LK+P++AK AL FFHW ++ F+HG+RSY I IH+L+ AGL+TDA+ALLES KN Sbjct: 78 LNLKEPMNAKKALTFFHWSSQDQNFRHGLRSYCIVIHILVHAGLLTDAQALLESCIKKNL 137 Query: 354 DS 359 S Sbjct: 138 AS 139 >CAN82481.1 hypothetical protein VITISV_012747 [Vitis vinifera] Length = 642 Score = 117 bits (294), Expect = 2e-28 Identities = 57/97 (58%), Positives = 72/97 (74%) Frame = +3 Query: 69 VSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAKTHRF 248 V+ +CDS RRG NWDA++ FGS+EL++S V +VLLELK PIDAK ALGFFHW A+ Sbjct: 41 VNMLCDSLRRGLNWDALNQRFGSLELTESFVGRVLLELKKPIDAKQALGFFHWSAQCKNL 100 Query: 249 KHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDS 359 +HGV SY I IH+L+ A L+ DA++LLES KN S Sbjct: 101 EHGVASYCITIHILVGAHLLMDAQSLLESTLKKNAGS 137 >XP_002305195.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE85706.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 556 Score = 117 bits (292), Expect = 3e-28 Identities = 56/99 (56%), Positives = 76/99 (76%) Frame = +3 Query: 66 IVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAKTHR 245 +VS+ICDS RRG NWD ++ +F S++L++ LV+ VLLELK+P DAK ALGFFHW A+ Sbjct: 46 VVSSICDSLRRGYNWDTLNRKFESLQLNNLLVKNVLLELKEPTDAKRALGFFHWSAR-RN 104 Query: 246 FKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDSP 362 F HGV+SY + IH+L++A L+ DA+ALLESL K+ P Sbjct: 105 FVHGVQSYCLMIHILIQARLIMDAQALLESLLKKSVGDP 143 >XP_003633738.2 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Vitis vinifera] Length = 549 Score = 116 bits (291), Expect = 5e-28 Identities = 56/97 (57%), Positives = 72/97 (74%) Frame = +3 Query: 69 VSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAKTHRF 248 V+ +CDS RRG NWDA++ FGS+EL++S V +VLLELK PIDAK ALGFFHW A+ Sbjct: 43 VNMLCDSLRRGLNWDALNQRFGSLELTESFVGRVLLELKKPIDAKQALGFFHWSAQCKNL 102 Query: 249 KHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDS 359 +HG+ SY I IH+L+ A L+ DA++LLES KN S Sbjct: 103 EHGLASYCITIHILVGAQLLMDAQSLLESTLKKNAGS 139 >XP_011002790.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Populus euphratica] XP_011002791.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Populus euphratica] Length = 556 Score = 116 bits (291), Expect = 5e-28 Identities = 56/99 (56%), Positives = 76/99 (76%) Frame = +3 Query: 66 IVSAICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWFAKTHR 245 +VS+ICDS RRG NWD ++ +F S++L++ LV+ VLLELK+P DAK ALGFFHW A+ Sbjct: 46 VVSSICDSLRRGYNWDTLNRKFESLQLNNLLVKNVLLELKEPTDAKRALGFFHWSAR-RN 104 Query: 246 FKHGVRSYSIAIHVLLRAGLVTDAKALLESLANKNTDSP 362 F HGV+SY + IHVL++A L+ DA+ALLES+ K+ P Sbjct: 105 FVHGVQSYCLMIHVLIQARLIMDAQALLESILKKSVGDP 143