BLASTX nr result
ID: Glycyrrhiza29_contig00025637
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00025637 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007140312.1 hypothetical protein PHAVU_008G101600g [Phaseolus... 108 1e-24 XP_014492073.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 5e-24 XP_014492072.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 5e-24 OIW01246.1 hypothetical protein TanjilG_10407 [Lupinus angustifo... 103 6e-23 XP_019460676.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 6e-23 XP_017419327.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-21 XP_017419323.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-21 XP_016198456.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 5e-20 XP_015960772.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 1e-19 XP_015903019.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 6e-19 XP_015890466.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 6e-19 XP_009355362.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 9e-19 XP_009341366.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 4e-18 XP_008378934.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 4e-18 XP_008361681.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 6e-18 XP_007226363.1 hypothetical protein PRUPE_ppa022421mg [Prunus pe... 89 1e-17 XP_016648052.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 89 1e-17 ONI36392.1 hypothetical protein PRUPE_1G583300 [Prunus persica] 89 1e-17 EEF30000.1 pentatricopeptide repeat-containing protein, putative... 87 3e-17 XP_015582844.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-17 >XP_007140312.1 hypothetical protein PHAVU_008G101600g [Phaseolus vulgaris] ESW12306.1 hypothetical protein PHAVU_008G101600g [Phaseolus vulgaris] Length = 896 Score = 108 bits (270), Expect = 1e-24 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LL CQYNYDEVAWK+L DGLLK+GYN+ECSMFL M+KKGC HPQTYAML+EGLDGT Sbjct: 839 LLCCQYNYDEVAWKVLIDGLLKNGYNDECSMFLKSMEKKGCQLHPQTYAMLVEGLDGT 896 >XP_014492073.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Vigna radiata var. radiata] Length = 792 Score = 107 bits (266), Expect = 5e-24 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LL CQYNYDEVAWK+L DGLLK+GYN+ECSMFL M+KKGC HPQTYAMLIEGL+GT Sbjct: 735 LLCCQYNYDEVAWKVLIDGLLKNGYNDECSMFLKSMEKKGCQLHPQTYAMLIEGLNGT 792 >XP_014492072.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Vigna radiata var. radiata] Length = 897 Score = 107 bits (266), Expect = 5e-24 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LL CQYNYDEVAWK+L DGLLK+GYN+ECSMFL M+KKGC HPQTYAMLIEGL+GT Sbjct: 840 LLCCQYNYDEVAWKVLIDGLLKNGYNDECSMFLKSMEKKGCQLHPQTYAMLIEGLNGT 897 >OIW01246.1 hypothetical protein TanjilG_10407 [Lupinus angustifolius] Length = 908 Score = 103 bits (258), Expect = 6e-23 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LLRCQYN DEVAWK+L DGLLK GYN+ECSMFL+LM++K C FHP TYAMLIEGL GT Sbjct: 851 LLRCQYNNDEVAWKVLIDGLLKRGYNDECSMFLNLMEEKDCRFHPHTYAMLIEGLHGT 908 >XP_019460676.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Lupinus angustifolius] Length = 921 Score = 103 bits (258), Expect = 6e-23 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LLRCQYN DEVAWK+L DGLLK GYN+ECSMFL+LM++K C FHP TYAMLIEGL GT Sbjct: 864 LLRCQYNNDEVAWKVLIDGLLKRGYNDECSMFLNLMEEKDCRFHPHTYAMLIEGLHGT 921 >XP_017419327.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Vigna angularis] Length = 788 Score = 99.8 bits (247), Expect = 2e-21 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEG 164 LL CQYNYDEVAWK+L DGLLK+GYN+ECSMFL M+KKGC HPQTYA+LIEG Sbjct: 734 LLCCQYNYDEVAWKVLIDGLLKNGYNDECSMFLKSMEKKGCQLHPQTYALLIEG 787 >XP_017419323.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Vigna angularis] XP_017419324.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Vigna angularis] XP_017419325.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Vigna angularis] KOM37996.1 hypothetical protein LR48_Vigan03g137800 [Vigna angularis] BAT84450.1 hypothetical protein VIGAN_04182900 [Vigna angularis var. angularis] Length = 893 Score = 99.8 bits (247), Expect = 2e-21 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEG 164 LL CQYNYDEVAWK+L DGLLK+GYN+ECSMFL M+KKGC HPQTYA+LIEG Sbjct: 839 LLCCQYNYDEVAWKVLIDGLLKNGYNDECSMFLKSMEKKGCQLHPQTYALLIEG 892 >XP_016198456.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis ipaensis] XP_016198457.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis ipaensis] XP_016198458.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis ipaensis] XP_016198459.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis ipaensis] Length = 906 Score = 95.5 bits (236), Expect = 5e-20 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LL QYN+DE+AWK+L DGLLK GYN+E SMFLSL +K GC FHP TYAMLI+GLDGT Sbjct: 849 LLCSQYNHDEMAWKVLIDGLLKRGYNDEYSMFLSLTQKMGCQFHPSTYAMLIDGLDGT 906 >XP_015960772.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis duranensis] XP_015960773.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis duranensis] XP_015960774.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis duranensis] XP_015960775.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Arachis duranensis] Length = 906 Score = 94.7 bits (234), Expect = 1e-19 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LL QYN+DE+AWK+L DGLLK GYN+E SMFLSL +K GC FHP TYAMLI+GLDGT Sbjct: 849 LLCSQYNHDEMAWKVLIDGLLKRGYNDEYSMFLSLTEKIGCQFHPSTYAMLIDGLDGT 906 >XP_015903019.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Ziziphus jujuba] Length = 870 Score = 92.4 bits (228), Expect = 6e-19 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LLRC YN DEVAWK+L DGLLK G + CS L +M+K GCH HPQTY+MLIEG+DGT Sbjct: 813 LLRCSYNSDEVAWKLLIDGLLKRGLVDRCSELLGIMEKMGCHLHPQTYSMLIEGMDGT 870 >XP_015890466.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Ziziphus jujuba] Length = 905 Score = 92.4 bits (228), Expect = 6e-19 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LLRC YN DEVAWK+L DGLLK G + CS L +M+K GCH HPQTY+MLIEG+DGT Sbjct: 848 LLRCSYNSDEVAWKLLIDGLLKRGLVDRCSELLGIMEKMGCHLHPQTYSMLIEGMDGT 905 >XP_009355362.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] Length = 905 Score = 92.0 bits (227), Expect = 9e-19 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDG 173 LL C+YNYDEVAWK+LFDGLLK G+ CS +S+M+K GC HPQTY+MLIEG+DG Sbjct: 848 LLLCEYNYDEVAWKVLFDGLLKRGFVNICSELISIMEKMGCRLHPQTYSMLIEGMDG 904 >XP_009341366.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] Length = 905 Score = 90.1 bits (222), Expect = 4e-18 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLD 170 LL C+YNYDEVAWK+LFDGLLK G CS +S+M+K GC HPQTY+MLIEG+D Sbjct: 848 LLHCEYNYDEVAWKVLFDGLLKRGLGNICSELISIMEKMGCRLHPQTYSMLIEGID 903 >XP_008378934.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Malus domestica] Length = 905 Score = 90.1 bits (222), Expect = 4e-18 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDG 173 LL C+YN+DEVAWK+LFDGLLK G+ CS +S+M+K GC HPQTY+MLIEG+DG Sbjct: 848 LLLCEYNHDEVAWKVLFDGLLKRGFVNICSELISIMEKMGCQLHPQTYSMLIEGMDG 904 >XP_008361681.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Malus domestica] XP_008361682.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Malus domestica] Length = 905 Score = 89.7 bits (221), Expect = 6e-18 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLD 170 LL C+YNYDEVAWK+LFDGLLK G CS +S+M+K GC HPQTY+MLIEG+D Sbjct: 848 LLHCEYNYDEVAWKVLFDGLLKRGLGNICSELISIMEKLGCRLHPQTYSMLIEGID 903 >XP_007226363.1 hypothetical protein PRUPE_ppa022421mg [Prunus persica] Length = 845 Score = 89.0 bits (219), Expect = 1e-17 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDG 173 LLRC YNYDEVAWK+L DGLLK G CS +S+M+K GC HPQTY+MLIEG+DG Sbjct: 788 LLRCGYNYDEVAWKVLLDGLLKRGLVNICSELVSIMEKMGCQLHPQTYSMLIEGIDG 844 >XP_016648052.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g65560-like [Prunus mume] Length = 896 Score = 89.0 bits (219), Expect = 1e-17 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDG 173 LLRC YNYDEVAWK+L DGLLK G CS +S+M+K GC HPQTY+MLIEG+DG Sbjct: 839 LLRCGYNYDEVAWKVLLDGLLKRGLVNICSELVSIMEKMGCQLHPQTYSMLIEGIDG 895 >ONI36392.1 hypothetical protein PRUPE_1G583300 [Prunus persica] Length = 915 Score = 89.0 bits (219), Expect = 1e-17 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDG 173 LLRC YNYDEVAWK+L DGLLK G CS +S+M+K GC HPQTY+MLIEG+DG Sbjct: 858 LLRCGYNYDEVAWKVLLDGLLKRGLVNICSELVSIMEKMGCQLHPQTYSMLIEGIDG 914 >EEF30000.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 676 Score = 87.4 bits (215), Expect = 3e-17 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LL+C YN DEVAWKIL DGLLK+G ++ CS L +M+ +GC HPQTY MLIEGLDGT Sbjct: 619 LLQCGYNDDEVAWKILIDGLLKNGLSDGCSELLGVMEARGCQIHPQTYRMLIEGLDGT 676 >XP_015582844.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Ricinus communis] XP_015582845.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Ricinus communis] XP_015582846.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Ricinus communis] XP_015582847.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Ricinus communis] XP_015582848.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Ricinus communis] Length = 906 Score = 87.4 bits (215), Expect = 4e-17 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = +3 Query: 3 LLRCQYNYDEVAWKILFDGLLKSGYNEECSMFLSLMKKKGCHFHPQTYAMLIEGLDGT 176 LL+C YN DEVAWKIL DGLLK+G ++ CS L +M+ +GC HPQTY MLIEGLDGT Sbjct: 849 LLQCGYNDDEVAWKILIDGLLKNGLSDGCSELLGVMEARGCQIHPQTYRMLIEGLDGT 906