BLASTX nr result
ID: Glycyrrhiza29_contig00024986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00024986 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004490581.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 87 4e-17 GAU25711.1 hypothetical protein TSUD_216400 [Trifolium subterran... 79 2e-14 XP_003615584.1 ATP-dependent zinc metalloprotease FTSH protein [... 64 6e-09 XP_019461317.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 57 2e-06 OIW02570.1 hypothetical protein TanjilG_24021 [Lupinus angustifo... 57 2e-06 XP_015932081.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 56 3e-06 XP_016166167.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 56 3e-06 >XP_004490581.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like [Cicer arietinum] Length = 804 Score = 87.0 bits (214), Expect = 4e-17 Identities = 46/72 (63%), Positives = 51/72 (70%) Frame = -1 Query: 346 DYYLPPLTHTKIYLHSYSAKSNFHHHWRKQNARRFVVPNSVPVRVLRHASFLRDSRRFDL 167 DYYL PLTHT IYLHS HH+R NA RFV PNS P+RVLRHA+F +D +RFDL Sbjct: 5 DYYLSPLTHTTIYLHS--------HHFR--NAHRFV-PNSSPIRVLRHANFFKDFKRFDL 53 Query: 166 WGGLKLNNDGAR 131 W GLKLNN R Sbjct: 54 WRGLKLNNTDLR 65 >GAU25711.1 hypothetical protein TSUD_216400 [Trifolium subterraneum] Length = 797 Score = 79.3 bits (194), Expect = 2e-14 Identities = 43/68 (63%), Positives = 49/68 (72%) Frame = -1 Query: 340 YLPPLTHTKIYLHSYSAKSNFHHHWRKQNARRFVVPNSVPVRVLRHASFLRDSRRFDLWG 161 YL PLTHT IYLHS HH+R NARRFV PNS P+RVLR A+FL+D +FDLW Sbjct: 6 YLSPLTHTTIYLHS--------HHFR--NARRFV-PNSAPIRVLRDANFLKDFGKFDLWR 54 Query: 160 GLKLNNDG 137 GLKLN+ G Sbjct: 55 GLKLNSKG 62 >XP_003615584.1 ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] AES98542.1 ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] Length = 793 Score = 63.5 bits (153), Expect = 6e-09 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 3/73 (4%) Frame = -1 Query: 340 YLPPLTHTKIYLHSYSAKSNFHHHWRKQNARRFVVPNSVPVRVLRHASFLRDSRRFDLWG 161 YL P TH I+LHS HH+R NARRFV+PNS +RVLR + FL + +F+LW Sbjct: 6 YLSPSTHATIFLHS--------HHFR--NARRFVIPNSPSIRVLRDSIFLNNFGKFELWK 55 Query: 160 GL--KLNN-DGAR 131 GL KL+N DG R Sbjct: 56 GLNTKLSNFDGLR 68 >XP_019461317.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like [Lupinus angustifolius] Length = 827 Score = 56.6 bits (135), Expect = 2e-06 Identities = 40/71 (56%), Positives = 42/71 (59%), Gaps = 8/71 (11%) Frame = -1 Query: 340 YLPPLTHTKIYLHSYSAKSNFHHHWR------KQNARRFVVPNSVPVRVLRHASFLRD-- 185 YL PLTHTK YL NF HHWR +QNA RF VP SVP RVLR A+ D Sbjct: 6 YLSPLTHTKTYL-------NF-HHWRNSPTSFRQNATRF-VPYSVPNRVLRPANSAIDFG 56 Query: 184 SRRFDLWGGLK 152 S RFDLW G K Sbjct: 57 SFRFDLWLGFK 67 >OIW02570.1 hypothetical protein TanjilG_24021 [Lupinus angustifolius] Length = 866 Score = 56.6 bits (135), Expect = 2e-06 Identities = 40/71 (56%), Positives = 42/71 (59%), Gaps = 8/71 (11%) Frame = -1 Query: 340 YLPPLTHTKIYLHSYSAKSNFHHHWR------KQNARRFVVPNSVPVRVLRHASFLRD-- 185 YL PLTHTK YL NF HHWR +QNA RF VP SVP RVLR A+ D Sbjct: 6 YLSPLTHTKTYL-------NF-HHWRNSPTSFRQNATRF-VPYSVPNRVLRPANSAIDFG 56 Query: 184 SRRFDLWGGLK 152 S RFDLW G K Sbjct: 57 SFRFDLWLGFK 67 >XP_015932081.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like [Arachis duranensis] Length = 796 Score = 55.8 bits (133), Expect = 3e-06 Identities = 36/79 (45%), Positives = 42/79 (53%), Gaps = 9/79 (11%) Frame = -1 Query: 340 YLPPLTHTKIYLHSYSAKSNFHHHWRKQNARRF--------VVPNSVPVRV-LRHASFLR 188 YL PLTHT++YL+S SNFH WR+ A F PNS RV RHA+F Sbjct: 6 YLSPLTHTQLYLNS---DSNFHR-WRRHTATSFRHVVTSTRFAPNSGQPRVPTRHANFST 61 Query: 187 DSRRFDLWGGLKLNNDGAR 131 DS RF +WG K D R Sbjct: 62 DSLRFHVWGDFKRGYDRIR 80 >XP_016166167.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like [Arachis ipaensis] Length = 831 Score = 55.8 bits (133), Expect = 3e-06 Identities = 36/79 (45%), Positives = 42/79 (53%), Gaps = 9/79 (11%) Frame = -1 Query: 340 YLPPLTHTKIYLHSYSAKSNFHHHWRKQNARRF--------VVPNSVPVRV-LRHASFLR 188 YL PLTHT++YL+S SNFH WR+ A F PNS RV RHA+F Sbjct: 6 YLSPLTHTQLYLNS---DSNFHR-WRRHTATSFRHAVTSTRFAPNSGQPRVPTRHANFST 61 Query: 187 DSRRFDLWGGLKLNNDGAR 131 DS RF +WG K D R Sbjct: 62 DSLRFHVWGDFKRGYDRIR 80