BLASTX nr result
ID: Glycyrrhiza29_contig00024798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00024798 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH45882.1 hypothetical protein GLYMA_08G298800 [Glycine max] 56 3e-08 >KRH45882.1 hypothetical protein GLYMA_08G298800 [Glycine max] Length = 79 Score = 56.2 bits (134), Expect = 3e-08 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = -1 Query: 126 SEFKIEKQQGVEDCCF---NLPIKYFCCFFW-FCFLSNP 22 SEF+IEK+ GV+DCC LPIKYFCCFF+ FCFLSNP Sbjct: 4 SEFEIEKE-GVQDCCSILQKLPIKYFCCFFFRFCFLSNP 41