BLASTX nr result
ID: Glycyrrhiza29_contig00024736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00024736 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004516657.1 PREDICTED: uncharacterized protein LOC101502338 [... 39 3e-10 KYP47494.1 hypothetical protein KK1_030891 [Cajanus cajan] 50 2e-08 XP_014635006.1 PREDICTED: uncharacterized protein LOC100792771 i... 39 6e-06 XP_003530888.1 PREDICTED: uncharacterized protein LOC100792771 i... 39 6e-06 >XP_004516657.1 PREDICTED: uncharacterized protein LOC101502338 [Cicer arietinum] Length = 294 Score = 39.3 bits (90), Expect(3) = 3e-10 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +1 Query: 289 LRLVWNVRRTPPTKDCSSSEIE--SEVQELSSYLEVSARCFTRNDEEKE 429 L LV +R+P SS EI + QE+SSY EVS RCF DE+K+ Sbjct: 105 LALVRTAQRSPSANVYSSPEIGMLNPAQEISSYTEVSPRCFGIKDEDKD 153 Score = 38.1 bits (87), Expect(3) = 3e-10 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = +3 Query: 123 PRLISKPSPVLPPSNFPRISQDFEDGGEMV 212 P ISKP P PPS F R S+D DGGE+V Sbjct: 50 PSPISKPLPPPPPSKFSRTSRDTSDGGEVV 79 Score = 33.9 bits (76), Expect(3) = 3e-10 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 218 DPWPYRSPRNVVRTSA*DSGESISFA 295 DPWPYR PR V R S DS E+ A Sbjct: 81 DPWPYRPPRKVARISGSDSCETSPLA 106 >KYP47494.1 hypothetical protein KK1_030891 [Cajanus cajan] Length = 293 Score = 50.1 bits (118), Expect(3) = 2e-08 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +1 Query: 289 LRLVWNVRRTPPTKDCSSSEIESEVQELSSYLEVSARCFTRNDEEKE 429 L LV + +RTPP K SS E QE+S Y EVS RCF RN+EEKE Sbjct: 107 LALVRSAQRTPPAKGFSSPE----AQEMSCYTEVSGRCFGRNEEEKE 149 Score = 31.6 bits (70), Expect(3) = 2e-08 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 215 HDPWPYRSPRNVVRTSA*DSGESISFAWS 301 +DPWPYR PR RT + S++ S Sbjct: 84 YDPWPYRPPRKAARTCPSEESSSLALVRS 112 Score = 23.1 bits (48), Expect(3) = 2e-08 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 141 PSPVLPPS-NFPRISQDFEDGGEMVH 215 P+P LPP F + +D D GE+V+ Sbjct: 59 PNPSLPPPPKFRKTLRDSGDSGEVVY 84 >XP_014635006.1 PREDICTED: uncharacterized protein LOC100792771 isoform X1 [Glycine max] KRH46822.1 hypothetical protein GLYMA_08G358600 [Glycine max] Length = 294 Score = 39.3 bits (90), Expect(3) = 6e-06 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = +1 Query: 289 LRLVWNVRRTPPTKDCSSSEIESEVQELSSYLEVSARCFTRNDEEKE 429 L LV +V+RTPP SS QE+S Y EVS RC+ RN+E +E Sbjct: 101 LALVRSVQRTPPPLKGFSSPA---AQEISCYTEVSPRCYGRNNEVEE 144 Score = 30.4 bits (67), Expect(3) = 6e-06 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 218 DPWPYRSPRNVVRT 259 DPWPYR PR + RT Sbjct: 79 DPWPYRPPRKIART 92 Score = 26.6 bits (57), Expect(3) = 6e-06 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 120 LPRLISKPSPVLPPSNFPRISQDFEDGGEMV 212 LP IS PSP P F ++ +D D GE+V Sbjct: 50 LPSPISNPSP---PPKFRKVLRDSGDSGEVV 77 >XP_003530888.1 PREDICTED: uncharacterized protein LOC100792771 isoform X2 [Glycine max] KRH46821.1 hypothetical protein GLYMA_08G358600 [Glycine max] Length = 287 Score = 39.3 bits (90), Expect(3) = 6e-06 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = +1 Query: 289 LRLVWNVRRTPPTKDCSSSEIESEVQELSSYLEVSARCFTRNDEEKE 429 L LV +V+RTPP SS QE+S Y EVS RC+ RN+E +E Sbjct: 101 LALVRSVQRTPPPLKGFSSPA---AQEISCYTEVSPRCYGRNNEVEE 144 Score = 30.4 bits (67), Expect(3) = 6e-06 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 218 DPWPYRSPRNVVRT 259 DPWPYR PR + RT Sbjct: 79 DPWPYRPPRKIART 92 Score = 26.6 bits (57), Expect(3) = 6e-06 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 120 LPRLISKPSPVLPPSNFPRISQDFEDGGEMV 212 LP IS PSP P F ++ +D D GE+V Sbjct: 50 LPSPISNPSP---PPKFRKVLRDSGDSGEVV 77