BLASTX nr result
ID: Glycyrrhiza29_contig00024274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00024274 (573 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004487460.1 PREDICTED: protein YLS9-like [Cicer arietinum] 55 7e-06 >XP_004487460.1 PREDICTED: protein YLS9-like [Cicer arietinum] Length = 235 Score = 55.1 bits (131), Expect = 7e-06 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = +3 Query: 72 MSISFNILHFSLFYHSNYLAETQLAPFQQDTKSQ 173 MS+++N+L S+FYHSNY+AE+ LAPF+QDTKS+ Sbjct: 116 MSVTYNVLRSSIFYHSNYIAESPLAPFKQDTKSE 149