BLASTX nr result
ID: Glycyrrhiza29_contig00024179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00024179 (414 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493649.1 PREDICTED: mediator of RNA polymerase II transcri... 84 3e-16 XP_013449700.1 mediator of RNA polymerase II transcription subun... 75 3e-13 XP_016205927.1 PREDICTED: mediator of RNA polymerase II transcri... 73 2e-12 XP_019419371.1 PREDICTED: mediator of RNA polymerase II transcri... 73 2e-12 XP_016205928.1 PREDICTED: mediator of RNA polymerase II transcri... 73 2e-12 KOM48818.1 hypothetical protein LR48_Vigan07g252200 [Vigna angul... 70 3e-12 BAT82466.1 hypothetical protein VIGAN_03248900 [Vigna angularis ... 70 3e-12 KDP40093.1 hypothetical protein JCGZ_02091 [Jatropha curcas] 72 3e-12 XP_012069510.1 PREDICTED: mediator of RNA polymerase II transcri... 72 4e-12 GAU20110.1 hypothetical protein TSUD_140100, partial [Trifolium ... 72 5e-12 XP_016197395.1 PREDICTED: mediator of RNA polymerase II transcri... 72 7e-12 XP_015939682.1 PREDICTED: mediator of RNA polymerase II transcri... 72 7e-12 XP_016196563.1 PREDICTED: mediator of RNA polymerase II transcri... 72 7e-12 XP_016197394.1 PREDICTED: mediator of RNA polymerase II transcri... 72 7e-12 BAT90298.1 hypothetical protein VIGAN_06151700 [Vigna angularis ... 68 8e-12 XP_015958679.1 PREDICTED: mediator of RNA polymerase II transcri... 71 9e-12 KRH20923.1 hypothetical protein GLYMA_13G209800 [Glycine max] 71 9e-12 OIV92578.1 hypothetical protein TanjilG_02341 [Lupinus angustifo... 71 9e-12 XP_006594439.1 PREDICTED: mediator of RNA polymerase II transcri... 71 9e-12 XP_010255865.1 PREDICTED: mediator of RNA polymerase II transcri... 71 9e-12 >XP_004493649.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Cicer arietinum] Length = 1339 Score = 84.0 bits (206), Expect = 3e-16 Identities = 43/66 (65%), Positives = 49/66 (74%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLLXXXXXXXXXXXXXXII 234 VSGFV LMVGCTPMWVRE D++LLKRLS+GLR+L+EHELALRLL II Sbjct: 1274 VSGFVGLMVGCTPMWVREADVELLKRLSKGLRQLDEHELALRLLEIGGIGVMGAAAEMII 1333 Query: 233 QFERRL 216 + ERRL Sbjct: 1334 EIERRL 1339 >XP_013449700.1 mediator of RNA polymerase II transcription subunit 33A [Medicago truncatula] KEH23728.1 mediator of RNA polymerase II transcription subunit 33A [Medicago truncatula] Length = 1338 Score = 75.5 bits (184), Expect = 3e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSL+V CTPMW+REVD +LLKRLS+GLR+LNE ELALRLL Sbjct: 1273 VSGFVSLIVCCTPMWIREVDAELLKRLSKGLRQLNEDELALRLL 1316 >XP_016205927.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33B-like [Arachis ipaensis] Length = 414 Score = 73.2 bits (178), Expect = 2e-12 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGF+SL+V CTP+WV E+D+D+LKRLS+GL ++NEHELALRLL Sbjct: 349 VSGFLSLIVSCTPLWVSEIDVDILKRLSKGLIQMNEHELALRLL 392 >XP_019419371.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Lupinus angustifolius] OIV95872.1 hypothetical protein TanjilG_06848 [Lupinus angustifolius] Length = 1329 Score = 73.2 bits (178), Expect = 2e-12 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD+D+LKRLS GLR LNE ELAL LL Sbjct: 1266 VSGFVSLMVGCTPNWVLEVDVDVLKRLSNGLRRLNEEELALALL 1309 >XP_016205928.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis ipaensis] Length = 1334 Score = 73.2 bits (178), Expect = 2e-12 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGF+SL+V CTP+WV E+D+D+LKRLS+GL ++NEHELALRLL Sbjct: 1269 VSGFLSLIVSCTPLWVSEIDVDILKRLSKGLIQMNEHELALRLL 1312 >KOM48818.1 hypothetical protein LR48_Vigan07g252200 [Vigna angularis] Length = 181 Score = 70.1 bits (170), Expect = 3e-12 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMV CTP WV EVDM +LKRLS GLR+LNE ELAL LL Sbjct: 118 VSGFVSLMVDCTPNWVLEVDMHVLKRLSNGLRQLNEEELALALL 161 >BAT82466.1 hypothetical protein VIGAN_03248900 [Vigna angularis var. angularis] Length = 187 Score = 70.1 bits (170), Expect = 3e-12 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMV CTP WV EVDM +LKRLS GLR+LNE ELAL LL Sbjct: 124 VSGFVSLMVDCTPNWVLEVDMHVLKRLSNGLRQLNEEELALALL 167 >KDP40093.1 hypothetical protein JCGZ_02091 [Jatropha curcas] Length = 650 Score = 72.4 bits (176), Expect = 3e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD D+LKRLS+GLR+ NE ELAL LL Sbjct: 588 VSGFVSLMVGCTPSWVMEVDADVLKRLSKGLRQWNEEELALALL 631 >XP_012069510.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A [Jatropha curcas] Length = 1323 Score = 72.4 bits (176), Expect = 4e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD D+LKRLS+GLR+ NE ELAL LL Sbjct: 1261 VSGFVSLMVGCTPSWVMEVDADVLKRLSKGLRQWNEEELALALL 1304 >GAU20110.1 hypothetical protein TSUD_140100, partial [Trifolium subterraneum] Length = 1330 Score = 72.0 bits (175), Expect = 5e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD+++LKRLS GLR+LNE ELAL LL Sbjct: 1267 VSGFVSLMVGCTPNWVLEVDVNVLKRLSNGLRQLNEEELALSLL 1310 >XP_016197395.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Arachis ipaensis] Length = 1131 Score = 71.6 bits (174), Expect = 7e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1068 VSGFVSLMVGCTPNWVLEVDVSVLKRLSNGLRQLNEEELALSLL 1111 >XP_015939682.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis duranensis] Length = 1320 Score = 71.6 bits (174), Expect = 7e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLM+GCTP+WV EVD+D+LKRLS GLR+L E ELAL LL Sbjct: 1257 VSGFVSLMIGCTPIWVLEVDVDVLKRLSNGLRQLYEEELALALL 1300 >XP_016196563.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis ipaensis] Length = 1324 Score = 71.6 bits (174), Expect = 7e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLM+GCTP+WV EVD+D+LKRLS GLR+L E ELAL LL Sbjct: 1261 VSGFVSLMIGCTPIWVLEVDVDVLKRLSNGLRQLYEEELALALL 1304 >XP_016197394.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Arachis ipaensis] Length = 1331 Score = 71.6 bits (174), Expect = 7e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1268 VSGFVSLMVGCTPNWVLEVDVSVLKRLSNGLRQLNEEELALSLL 1311 >BAT90298.1 hypothetical protein VIGAN_06151700 [Vigna angularis var. angularis] Length = 137 Score = 67.8 bits (164), Expect = 8e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMV CTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 74 VSGFVSLMVDCTPNWVLEVDVHVLKRLSNGLRQLNEEELALVLL 117 >XP_015958679.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Arachis duranensis] Length = 1131 Score = 71.2 bits (173), Expect = 9e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1068 VSGFVSLMVGCTPNWVLEVDVSVLKRLSMGLRQLNEEELALSLL 1111 >KRH20923.1 hypothetical protein GLYMA_13G209800 [Glycine max] Length = 1132 Score = 71.2 bits (173), Expect = 9e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1069 VSGFVSLMVGCTPNWVLEVDVHVLKRLSNGLRQLNEEELALALL 1112 >OIV92578.1 hypothetical protein TanjilG_02341 [Lupinus angustifolius] Length = 1187 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 V+GFVSLMV CTP+WV EVD D+LKRLSRGL LNE+ELA RLL Sbjct: 1122 VTGFVSLMVACTPLWVPEVDADILKRLSRGLIRLNEYELAFRLL 1165 >XP_006594439.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Glycine max] Length = 1195 Score = 71.2 bits (173), Expect = 9e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1132 VSGFVSLMVGCTPNWVLEVDVHVLKRLSNGLRQLNEEELALALL 1175 >XP_010255865.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A isoform X3 [Nelumbo nucifera] Length = 1213 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 413 VSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 282 VSGFVSLMVGCTP WV EV++D+LKRLS+GLR+ NE ELAL LL Sbjct: 1150 VSGFVSLMVGCTPTWVLEVEVDVLKRLSKGLRQWNEEELALALL 1193