BLASTX nr result
ID: Glycyrrhiza29_contig00023129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00023129 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007216692.1 hypothetical protein PRUPE_ppa026731mg [Prunus pe... 54 3e-06 >XP_007216692.1 hypothetical protein PRUPE_ppa026731mg [Prunus persica] Length = 200 Score = 53.5 bits (127), Expect = 3e-06 Identities = 34/85 (40%), Positives = 45/85 (52%), Gaps = 3/85 (3%) Frame = +3 Query: 9 IPAV--SPIMAESSALREAMSLASNMGMKRMAFECDCLQP-VQAWVAREGNVDAHTVAQL 179 IP+V S I AE+ A E LA+ MG +++ FE DC + V W+ R N A +A L Sbjct: 107 IPSVANSAIEAEAQACLEDCKLAAEMGYRQVTFESDCKETYVWTWIPRTANQAADHLAML 166 Query: 180 AKQRNLPGNWIWTPPPRLKQILDID 254 A R P W+ PP L IL+ D Sbjct: 167 AISRMSPEVWVNRPPSSLMHILNKD 191