BLASTX nr result
ID: Glycyrrhiza29_contig00022935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00022935 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU30266.1 hypothetical protein TSUD_384870, partial [Trifolium ... 84 4e-17 XP_004485725.1 PREDICTED: putative disease resistance protein At... 82 1e-16 XP_012568023.1 PREDICTED: putative disease resistance protein At... 82 1e-16 XP_012568027.1 PREDICTED: LOW QUALITY PROTEIN: putative disease ... 82 1e-16 XP_004485726.1 PREDICTED: putative disease resistance protein At... 80 7e-16 XP_012568623.1 PREDICTED: putative disease resistance protein At... 80 7e-16 XP_012568627.1 PREDICTED: putative disease resistance protein At... 80 7e-16 XP_012569263.1 PREDICTED: putative disease resistance protein At... 79 1e-15 GAU46858.1 hypothetical protein TSUD_385350 [Trifolium subterran... 79 2e-15 GAU23571.1 hypothetical protein TSUD_385570 [Trifolium subterran... 79 2e-15 GAU23575.1 hypothetical protein TSUD_385630 [Trifolium subterran... 78 3e-15 XP_003593667.1 NB-ARC domain disease resistance protein [Medicag... 78 4e-15 GAU23570.1 hypothetical protein TSUD_385560 [Trifolium subterran... 77 6e-15 XP_003593669.1 LRR and NB-ARC domain disease resistance protein ... 77 8e-15 GAU23584.1 hypothetical protein TSUD_385720 [Trifolium subterran... 75 4e-14 XP_012567551.1 PREDICTED: LOW QUALITY PROTEIN: putative disease ... 75 5e-14 XP_003617828.1 LRR and NB-ARC domain disease resistance protein ... 74 7e-14 GAU23579.1 hypothetical protein TSUD_385670 [Trifolium subterran... 74 1e-13 ABN08729.1 Leucine-rich repeat [Medicago truncatula] 73 2e-13 XP_003593660.1 NB-ARC domain disease resistance protein [Medicag... 73 2e-13 >GAU30266.1 hypothetical protein TSUD_384870, partial [Trifolium subterraneum] Length = 1136 Score = 83.6 bits (205), Expect = 4e-17 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 ++NC L+ LPCH NTLLPKL+DV I CPE+ETF +G +PPSLR L I +CEKLLR Sbjct: 1039 IINCSNLKSLPCHINTLLPKLQDVVINNCPEMETFPEGGMPPSLRYLGIWSCEKLLR 1095 >XP_004485725.1 PREDICTED: putative disease resistance protein At3g14460 isoform X2 [Cicer arietinum] Length = 1220 Score = 82.4 bits (202), Expect = 1e-16 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V C+ L+ LPCHANTLLP LE V+I CPE+ETF +G +PPSLR LEI CEKL+R Sbjct: 1040 VEKCVNLKSLPCHANTLLPNLESVSIRDCPEMETFCEGGMPPSLRRLEIYKCEKLVR 1096 >XP_012568023.1 PREDICTED: putative disease resistance protein At3g14460 isoform X1 [Cicer arietinum] AHB64352.1 NBS-LRR protein [Cicer arietinum] Length = 1258 Score = 82.4 bits (202), Expect = 1e-16 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V C+ L+ LPCHANTLLP LE V+I CPE+ETF +G +PPSLR LEI CEKL+R Sbjct: 1078 VEKCVNLKSLPCHANTLLPNLESVSIRDCPEMETFCEGGMPPSLRRLEIYKCEKLVR 1134 >XP_012568027.1 PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein At3g14460 [Cicer arietinum] Length = 1258 Score = 82.0 bits (201), Expect = 1e-16 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V C+ L+ LPCHANTLLPKLE ++I CPE+ETF +G +PPSLR L+I+ CEKL+R Sbjct: 1078 VSKCVNLKSLPCHANTLLPKLEYLSIWDCPEMETFCEGGMPPSLRILDIKKCEKLMR 1134 >XP_004485726.1 PREDICTED: putative disease resistance protein At3g14460 [Cicer arietinum] AHB64351.1 NBS-LRR protein [Cicer arietinum] Length = 1229 Score = 80.1 bits (196), Expect = 7e-16 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V C+ L+ LPCHANTLLPKLE ++I CPE+ETF +G +PPSLR L I CEKL+R Sbjct: 1050 VEKCVNLKSLPCHANTLLPKLEYLSIWECPEMETFCEGSMPPSLRRLVIYKCEKLMR 1106 >XP_012568623.1 PREDICTED: putative disease resistance protein At3g14460 isoform X1 [Cicer arietinum] XP_012568624.1 PREDICTED: putative disease resistance protein At3g14460 isoform X1 [Cicer arietinum] XP_012568625.1 PREDICTED: putative disease resistance protein At3g14460 isoform X1 [Cicer arietinum] XP_012568626.1 PREDICTED: putative disease resistance protein At3g14460 isoform X1 [Cicer arietinum] Length = 1260 Score = 80.1 bits (196), Expect = 7e-16 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V C+ L+ LPCHANTLLP LE V I CPE+ETF +G +PPSLR L+I CEKL+R Sbjct: 1078 VCRCVNLKSLPCHANTLLPNLEMVRIWDCPEMETFCEGGMPPSLRRLDIYKCEKLMR 1134 >XP_012568627.1 PREDICTED: putative disease resistance protein At3g14460 isoform X2 [Cicer arietinum] Length = 1269 Score = 80.1 bits (196), Expect = 7e-16 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V C+ L+ LPCHANTLLP LE V I CPE+ETF +G +PPSLR L+I CEKL+R Sbjct: 1087 VCRCVNLKSLPCHANTLLPNLEMVRIWDCPEMETFCEGGMPPSLRRLDIYKCEKLMR 1143 >XP_012569263.1 PREDICTED: putative disease resistance protein At3g14460 [Cicer arietinum] Length = 548 Score = 79.3 bits (194), Expect = 1e-15 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V +C+ L+ L CHANTLL LE V+I CPE+ETF +G +PPSLRSL+IE CEKL+R Sbjct: 371 VFDCVNLKSLTCHANTLLRNLEIVSIWNCPEMETFCEGGVPPSLRSLDIEKCEKLMR 427 >GAU46858.1 hypothetical protein TSUD_385350 [Trifolium subterraneum] Length = 1273 Score = 79.0 bits (193), Expect = 2e-15 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 ++ C L+ LPCH NTLLPKL+DV I CPE+E F +G +PPSLR L I CEKLLR Sbjct: 1093 IIKCSNLKSLPCHINTLLPKLQDVVIDNCPEMEMFPEGGMPPSLRLLHIWKCEKLLR 1149 >GAU23571.1 hypothetical protein TSUD_385570 [Trifolium subterraneum] Length = 1264 Score = 78.6 bits (192), Expect = 2e-15 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 + +C K LPCH NTLLPKL+ + +G CPE+ETF +G +PPSLRSL I NCEKL+R Sbjct: 869 ICDCPKFVSLPCHINTLLPKLQLMHVGNCPEMETFPEGGMPPSLRSLHIWNCEKLMR 925 >GAU23575.1 hypothetical protein TSUD_385630 [Trifolium subterraneum] Length = 627 Score = 78.2 bits (191), Expect = 3e-15 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 + C L+ LPCH NTLLPKL+D I CPE+ETF +G +PPSLR+L I +CEKLLR Sbjct: 533 ISKCSNLKSLPCHINTLLPKLQDAVIENCPEMETFPEGGMPPSLRTLYILSCEKLLR 589 >XP_003593667.1 NB-ARC domain disease resistance protein [Medicago truncatula] AES63918.1 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 884 Score = 77.8 bits (190), Expect = 4e-15 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 + NC+ L+ LPCH NTLLPKL+ + + CP+IETF +G +P SLRS I NCEKLLR Sbjct: 425 IFNCVNLKSLPCHVNTLLPKLDTLLMFDCPKIETFPEGGMPLSLRSFSIRNCEKLLR 481 >GAU23570.1 hypothetical protein TSUD_385560 [Trifolium subterraneum] Length = 1236 Score = 77.4 bits (189), Expect = 6e-15 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEI-ENCEKLLR 46 +++C L+ LPCH NTLLPKL+++ I CPE+ETF +G +PPSLRSL I NCEKLLR Sbjct: 1054 IIDCPNLKSLPCHINTLLPKLQEMHIDKCPEMETFPEGGMPPSLRSLYITRNCEKLLR 1111 >XP_003593669.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES63920.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1250 Score = 77.0 bits (188), Expect = 8e-15 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V +C+KL+ LPCH NTLLPKL +V + CP+IETF + +P SLRSL + NCEKLLR Sbjct: 1070 VSDCVKLKSLPCHVNTLLPKLNNVQMSNCPKIETFPEEGMPHSLRSLLVGNCEKLLR 1126 >GAU23584.1 hypothetical protein TSUD_385720 [Trifolium subterraneum] Length = 1261 Score = 75.1 bits (183), Expect = 4e-14 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 + C+ L+ LPCH NTLLPKL+ VTI CPE+ETF + +P SLRSL I NCE LLR Sbjct: 1079 IYKCVSLKSLPCHVNTLLPKLDTVTIYDCPEMETFPERGMPRSLRSLYITNCEILLR 1135 >XP_012567551.1 PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein At3g14460 [Cicer arietinum] Length = 1198 Score = 74.7 bits (182), Expect = 5e-14 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = -3 Query: 207 CIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 C+ L+ LPC ANTLLP LE V I CPE+ETF +G +P SLR L+IE CEKL+R Sbjct: 1046 CVNLKSLPCQANTLLPNLEVVRIRDCPEMETFCEGGMPLSLRRLDIEKCEKLMR 1099 >XP_003617828.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AET00787.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1242 Score = 74.3 bits (181), Expect = 7e-14 Identities = 34/57 (59%), Positives = 40/57 (70%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 + NC L+ LPCH NTLLPKL DV + CP E F +G +P SLRSL + NCEKLLR Sbjct: 1062 IFNCFNLKSLPCHVNTLLPKLNDVQMYDCPNTEMFPEGGMPRSLRSLCVGNCEKLLR 1118 >GAU23579.1 hypothetical protein TSUD_385670 [Trifolium subterraneum] Length = 977 Score = 73.6 bits (179), Expect = 1e-13 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 + NC L+ L CH NTLLPKL+D+ I CPE+ETF + + PSLRSL I NCEKLLR Sbjct: 783 ITNCSNLKSLHCHINTLLPKLQDMHIDKCPEMETFPERGMLPSLRSLCIRNCEKLLR 839 >ABN08729.1 Leucine-rich repeat [Medicago truncatula] Length = 588 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V + + L+ LPCH NTLLP L+ +++ CPEIE F +G +PPSLR L + NCEKLLR Sbjct: 358 VSHYVNLKALPCHVNTLLPNLQRISVSHCPEIEVFPEGGMPPSLRRLCVVNCEKLLR 414 >XP_003593660.1 NB-ARC domain disease resistance protein [Medicago truncatula] AES63911.1 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1215 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = -3 Query: 216 VVNCIKLRPLPCHANTLLPKLEDVTIGGCPEIETFLDGCLPPSLRSLEIENCEKLLR 46 V + + L+ LPCH NTLLP L+ +++ CPEIE F +G +PPSLR L + NCEKLLR Sbjct: 964 VSHYVNLKALPCHVNTLLPNLQRISVSHCPEIEVFPEGGMPPSLRRLCVVNCEKLLR 1020