BLASTX nr result
ID: Glycyrrhiza29_contig00022639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00022639 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAC41957.1 putative heat shock protein [Arabidopsis thaliana] 107 3e-28 EEF45953.1 conserved hypothetical protein [Ricinus communis] 107 3e-28 XP_010670765.1 PREDICTED: dnaJ homolog subfamily B member 4 [Bet... 113 2e-27 XP_009117486.1 PREDICTED: dnaJ homolog subfamily B member 13 [Br... 113 2e-27 XP_013664272.1 PREDICTED: dnaJ homolog subfamily B member 13-lik... 113 2e-27 XP_002961542.1 hypothetical protein SELMODRAFT_230025 [Selaginel... 111 6e-27 XP_018440483.1 PREDICTED: dnaJ homolog subfamily B member 13-lik... 112 7e-27 BAT78219.1 hypothetical protein VIGAN_02087000 [Vigna angularis ... 112 8e-27 XP_002971272.1 hypothetical protein SELMODRAFT_231730 [Selaginel... 111 8e-27 XP_008219853.1 PREDICTED: dnaJ homolog subfamily B member 1 [Pru... 111 9e-27 XP_007224208.1 hypothetical protein PRUPE_ppa017410mg [Prunus pe... 111 9e-27 XP_006298073.1 hypothetical protein CARUB_v10014117mg [Capsella ... 111 1e-26 KDO49584.1 hypothetical protein CISIN_1g029075mg [Citrus sinensis] 107 2e-26 XP_007137077.1 hypothetical protein PHAVU_009G097800g [Phaseolus... 110 2e-26 CUQ97479.1 Chaperone protein DnaJ [Escherichia coli] 103 3e-26 KRH61858.1 hypothetical protein GLYMA_04G0720001, partial [Glyci... 105 3e-26 KDO56647.1 hypothetical protein CISIN_1g0195732mg, partial [Citr... 107 3e-26 XP_013605450.1 PREDICTED: dnaJ homolog subfamily B member 13 [Br... 110 3e-26 ABR16557.1 unknown [Picea sitchensis] 110 3e-26 XP_003603470.1 DnaJ heat shock family protein [Medicago truncatu... 109 4e-26 >BAC41957.1 putative heat shock protein [Arabidopsis thaliana] Length = 57 Score = 107 bits (268), Expect = 3e-28 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYY L+VDRNA +DDLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAY+V Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDV 56 >EEF45953.1 conserved hypothetical protein [Ricinus communis] Length = 61 Score = 107 bits (268), Expect = 3e-28 Identities = 48/55 (87%), Positives = 54/55 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYE 267 MGVDYYN LKV+RNAT+DDLKK+YR+LAMKWHPDKNPNNKK+AE+KFKQISEAYE Sbjct: 1 MGVDYYNVLKVNRNATDDDLKKSYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYE 55 >XP_010670765.1 PREDICTED: dnaJ homolog subfamily B member 4 [Beta vulgaris subsp. vulgaris] KMT16890.1 hypothetical protein BVRB_2g043650 [Beta vulgaris subsp. vulgaris] Length = 330 Score = 113 bits (282), Expect = 2e-27 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN+L+VDRNAT+DDLKKAYRKLAMKWHPDKNPNNKK+AE+KFKQISEAYEV Sbjct: 1 MGVDYYNELQVDRNATDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEV 56 >XP_009117486.1 PREDICTED: dnaJ homolog subfamily B member 13 [Brassica rapa] Length = 338 Score = 113 bits (282), Expect = 2e-27 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN L+VDRNA+EDDLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLQVDRNASEDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYEV 56 >XP_013664272.1 PREDICTED: dnaJ homolog subfamily B member 13-like [Brassica napus] CDY13869.1 BnaA09g43710D [Brassica napus] Length = 338 Score = 113 bits (282), Expect = 2e-27 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN L+VDRNA+EDDLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLQVDRNASEDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYEV 56 >XP_002961542.1 hypothetical protein SELMODRAFT_230025 [Selaginella moellendorffii] EFJ36802.1 hypothetical protein SELMODRAFT_230025 [Selaginella moellendorffii] Length = 294 Score = 111 bits (277), Expect = 6e-27 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MG+DYY+ LKVD+NATEDDLKKAYRKLAMKWHPDKNPNNKK+AE+KFKQISEAYEV Sbjct: 1 MGIDYYSVLKVDKNATEDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEV 56 >XP_018440483.1 PREDICTED: dnaJ homolog subfamily B member 13-like [Raphanus sativus] Length = 343 Score = 112 bits (279), Expect = 7e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN L+VDRNA++DDLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLQVDRNASDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYEV 56 >BAT78219.1 hypothetical protein VIGAN_02087000 [Vigna angularis var. angularis] Length = 350 Score = 112 bits (279), Expect = 8e-27 Identities = 50/62 (80%), Positives = 59/62 (95%) Frame = +1 Query: 85 FLKKKKMGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAY 264 F++K+ MGVDYY+ LKV+RNATEDD+KK+YRKLAMKWHPDKNPNNKK+AE+ FKQISEAY Sbjct: 17 FVEKENMGVDYYDVLKVNRNATEDDVKKSYRKLAMKWHPDKNPNNKKEAEANFKQISEAY 76 Query: 265 EV 270 EV Sbjct: 77 EV 78 >XP_002971272.1 hypothetical protein SELMODRAFT_231730 [Selaginella moellendorffii] EFJ27870.1 hypothetical protein SELMODRAFT_231730 [Selaginella moellendorffii] Length = 311 Score = 111 bits (277), Expect = 8e-27 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MG+DYY+ LKVD+NATEDDLKKAYRKLAMKWHPDKNPNNKK+AE+KFKQISEAYEV Sbjct: 1 MGIDYYSVLKVDKNATEDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEV 56 >XP_008219853.1 PREDICTED: dnaJ homolog subfamily B member 1 [Prunus mume] Length = 334 Score = 111 bits (278), Expect = 9e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN LKV+RNATEDDLKKAYR+LAMKWHPDKNPNNKK+AE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLKVNRNATEDDLKKAYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEV 56 >XP_007224208.1 hypothetical protein PRUPE_ppa017410mg [Prunus persica] ONI34180.1 hypothetical protein PRUPE_1G466900 [Prunus persica] Length = 334 Score = 111 bits (278), Expect = 9e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN LKV+RNATEDDLKKAYR+LAMKWHPDKNPNNKK+AE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLKVNRNATEDDLKKAYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEV 56 >XP_006298073.1 hypothetical protein CARUB_v10014117mg [Capsella rubella] EOA30971.1 hypothetical protein CARUB_v10014117mg [Capsella rubella] Length = 339 Score = 111 bits (277), Expect = 1e-26 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN L+VDR+A+EDDLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLQVDRSASEDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYEV 56 >KDO49584.1 hypothetical protein CISIN_1g029075mg [Citrus sinensis] Length = 199 Score = 107 bits (267), Expect = 2e-26 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYY L VDRNA +DDLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAYEV Sbjct: 1 MGVDYYKILGVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAETKFKQISEAYEV 56 >XP_007137077.1 hypothetical protein PHAVU_009G097800g [Phaseolus vulgaris] ESW09071.1 hypothetical protein PHAVU_009G097800g [Phaseolus vulgaris] Length = 333 Score = 110 bits (275), Expect = 2e-26 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = +1 Query: 88 LKKKKMGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYE 267 ++K++MGVDYY+ LKV+RNATEDDLKKAYRKLAMKWHPDKNP NKK+AE+ FKQISEAYE Sbjct: 1 MEKEEMGVDYYDVLKVNRNATEDDLKKAYRKLAMKWHPDKNPTNKKEAEANFKQISEAYE 60 Query: 268 V 270 V Sbjct: 61 V 61 >CUQ97479.1 Chaperone protein DnaJ [Escherichia coli] Length = 80 Score = 103 bits (257), Expect = 3e-26 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYY L+VDRNA ++DLKKAYRKLAMKWHPDKNP NKKDAE+KFKQISEAY+V Sbjct: 1 MGVDYYKILQVDRNAKDEDLKKAYRKLAMKWHPDKNPKNKKDAEAKFKQISEAYDV 56 >KRH61858.1 hypothetical protein GLYMA_04G0720001, partial [Glycine max] Length = 142 Score = 105 bits (262), Expect = 3e-26 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MG+DYYN LKV+RNA+EDDLKKAYRKLAMKWHPDKNP NKK+AE+ FKQISEAYEV Sbjct: 1 MGLDYYNVLKVNRNASEDDLKKAYRKLAMKWHPDKNPTNKKEAEATFKQISEAYEV 56 >KDO56647.1 hypothetical protein CISIN_1g0195732mg, partial [Citrus sinensis] Length = 195 Score = 107 bits (266), Expect = 3e-26 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYY L+VDRNA E+DLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAY+V Sbjct: 1 MGVDYYKILQVDRNAKEEDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDV 56 >XP_013605450.1 PREDICTED: dnaJ homolog subfamily B member 13 [Brassica oleracea var. oleracea] XP_013733106.1 PREDICTED: dnaJ homolog subfamily B member 13-like [Brassica napus] CDY65077.1 BnaA09g55990D [Brassica napus] Length = 336 Score = 110 bits (274), Expect = 3e-26 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN L+VDRNA+++DLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLQVDRNASDNDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYEV 56 >ABR16557.1 unknown [Picea sitchensis] Length = 336 Score = 110 bits (274), Expect = 3e-26 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN L V RNATEDDLKKAYRKLAMKWHPDKNPNNKK+AE+KFKQISEAYEV Sbjct: 1 MGVDYYNVLNVGRNATEDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEV 56 >XP_003603470.1 DnaJ heat shock family protein [Medicago truncatula] AES73721.1 DnaJ heat shock family protein [Medicago truncatula] Length = 327 Score = 109 bits (273), Expect = 4e-26 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +1 Query: 103 MGVDYYNKLKVDRNATEDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEAYEV 270 MGVDYYN LKVD+NATEDDLKKAYRKLAMKWHPDKNPNNKK+AE++FKQISEAY V Sbjct: 1 MGVDYYNILKVDKNATEDDLKKAYRKLAMKWHPDKNPNNKKEAEARFKQISEAYAV 56