BLASTX nr result
ID: Glycyrrhiza29_contig00022384
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00022384 (228 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN40157.1 hypothetical protein glysoja_028778, partial [Glycine... 55 2e-08 GAU10400.1 hypothetical protein TSUD_423410, partial [Trifolium ... 53 2e-06 GAU33259.1 hypothetical protein TSUD_333820 [Trifolium subterran... 52 5e-06 >KHN40157.1 hypothetical protein glysoja_028778, partial [Glycine soja] Length = 94 Score = 55.5 bits (132), Expect = 2e-08 Identities = 27/57 (47%), Positives = 33/57 (57%) Frame = +3 Query: 18 VQFLHVYPSIILSTQELLQRDWEVTLRHNLREGNFCVDFLSCLIVDSGFCVTHRSDP 188 V H Y SII S QELL+ W V L+H+LREGN C DFL+ + +SG P Sbjct: 18 VDVRHRYASIIASVQELLRNTWNVVLKHSLREGNLCADFLTRMGSNSGSAYLELDSP 74 >GAU10400.1 hypothetical protein TSUD_423410, partial [Trifolium subterraneum] Length = 284 Score = 53.1 bits (126), Expect = 2e-06 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = +3 Query: 30 HVYPSIILSTQELLQRDWEVTLRHNLREGNFCVDFLSCL 146 H Y +II + Q+LL +W+V+L+H+LREGNFC DFL+ L Sbjct: 212 HCYAAIIANIQDLLVLEWDVSLKHSLREGNFCADFLAKL 250 >GAU33259.1 hypothetical protein TSUD_333820 [Trifolium subterraneum] Length = 284 Score = 52.0 bits (123), Expect = 5e-06 Identities = 21/39 (53%), Positives = 31/39 (79%) Frame = +3 Query: 30 HVYPSIILSTQELLQRDWEVTLRHNLREGNFCVDFLSCL 146 H Y +II + Q+LL +W+V+L+H++REGNFC DFL+ L Sbjct: 212 HCYAAIIANIQDLLVLEWDVSLKHSVREGNFCADFLAKL 250