BLASTX nr result
ID: Glycyrrhiza29_contig00022064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00022064 (480 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006591322.1 PREDICTED: uncharacterized protein LOC102669706 [... 59 8e-08 KYP76005.1 Importin-5 [Cajanus cajan] 60 1e-07 XP_007163361.1 hypothetical protein PHAVU_001G228200g, partial [... 58 8e-07 XP_004503108.1 PREDICTED: importin-5-like [Cicer arietinum] 56 4e-06 >XP_006591322.1 PREDICTED: uncharacterized protein LOC102669706 [Glycine max] KRH30912.1 hypothetical protein GLYMA_11G214000 [Glycine max] Length = 744 Score = 58.5 bits (140), Expect(2) = 8e-08 Identities = 28/41 (68%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -2 Query: 248 HTTIETLFHHL-YSPQQQQR*SQALTFLQCSKHHHPDLLFI 129 +T +ETLF HL YSP +Q SQAL F QC KHHHPDLLFI Sbjct: 28 NTAMETLFSHLFYSPHSEQLRSQALEFFQCCKHHHPDLLFI 68 Score = 25.0 bits (53), Expect(2) = 8e-08 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 292 QIISLTFEVLSSNDNTPP*KLYS 224 ++ S F+VLSSNDNT L+S Sbjct: 14 ELQSKAFQVLSSNDNTAMETLFS 36 >KYP76005.1 Importin-5 [Cajanus cajan] Length = 712 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 239 IETLFHHLYSPQQQQR*SQALTFLQCSKHHHPDLLFI 129 +ETLF HLYSPQ Q R SQAL FLQC K HHPDLLFI Sbjct: 1 METLFSHLYSPQHQHR-SQALAFLQCCKRHHPDLLFI 36 >XP_007163361.1 hypothetical protein PHAVU_001G228200g, partial [Phaseolus vulgaris] ESW35355.1 hypothetical protein PHAVU_001G228200g, partial [Phaseolus vulgaris] Length = 635 Score = 57.8 bits (138), Expect = 8e-07 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 3/43 (6%) Frame = -2 Query: 248 HTTIETLFHHLYSPQQQQR*S---QALTFLQCSKHHHPDLLFI 129 +T IETLF H+YSPQ Q + S AL FLQC KHHHPDLL I Sbjct: 23 NTPIETLFSHIYSPQHQNQHSLRSHALAFLQCCKHHHPDLLLI 65 >XP_004503108.1 PREDICTED: importin-5-like [Cicer arietinum] Length = 751 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 5/44 (11%) Frame = -2 Query: 245 TTIETLFHHLYS--PQ---QQQR*SQALTFLQCSKHHHPDLLFI 129 T +ETLF HLY PQ QQQ+ SQALTFLQC K+HHPDLL I Sbjct: 23 TAMETLFSHLYPNPPQNQNQQQQKSQALTFLQCCKYHHPDLLMI 66