BLASTX nr result
ID: Glycyrrhiza29_contig00021759
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021759 (527 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK39333.1 unknown [Lotus japonicus] 64 1e-09 KRH59831.1 hypothetical protein GLYMA_05G204700 [Glycine max] 65 1e-09 ONK61032.1 uncharacterized protein A4U43_C08F25380 [Asparagus of... 62 2e-09 XP_013654499.1 PREDICTED: bifunctional UDP-glucose 4-epimerase a... 62 4e-09 ONM56633.1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4... 62 6e-09 JAT43004.1 UDP-glucose 4-epimerase 1 [Anthurium amnicola] 64 7e-09 KRH41130.1 hypothetical protein GLYMA_08G011800 [Glycine max] 64 9e-09 KRH41128.1 hypothetical protein GLYMA_08G011800 [Glycine max] 64 9e-09 KYP45152.1 UDP-glucose 4-epimerase [Cajanus cajan] 64 1e-08 XP_014510518.1 PREDICTED: bifunctional UDP-glucose 4-epimerase a... 64 1e-08 KOM57075.1 hypothetical protein LR48_Vigan11g010700 [Vigna angul... 64 1e-08 Q43070.1 RecName: Full=UDP-glucose 4-epimerase; AltName: Full=Ga... 64 1e-08 XP_004503750.1 PREDICTED: bifunctional UDP-glucose 4-epimerase a... 64 1e-08 XP_003532591.1 PREDICTED: bifunctional UDP-glucose 4-epimerase a... 64 1e-08 B0M3E8.2 RecName: Full=Bifunctional UDP-glucose 4-epimerase and ... 64 1e-08 XP_019072767.1 PREDICTED: bifunctional UDP-glucose 4-epimerase a... 64 1e-08 AFK43339.1 unknown [Lotus japonicus] 64 1e-08 XP_017441371.1 PREDICTED: bifunctional UDP-glucose 4-epimerase a... 64 1e-08 BAT73112.1 hypothetical protein VIGAN_01057100 [Vigna angularis ... 64 1e-08 KJB25715.1 hypothetical protein B456_004G209200 [Gossypium raimo... 62 1e-08 >AFK39333.1 unknown [Lotus japonicus] Length = 142 Score = 63.5 bits (153), Expect = 1e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 3 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 31 >KRH59831.1 hypothetical protein GLYMA_05G204700 [Glycine max] Length = 275 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVRKTHTYTVNF 412 YIQQVAVGRL ELNVYGHDYPTRDGSAVRK Y+ + Sbjct: 211 YIQQVAVGRLTELNVYGHDYPTRDGSAVRKIQPYSTMY 248 >ONK61032.1 uncharacterized protein A4U43_C08F25380 [Asparagus officinalis] Length = 120 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPT+DGSA+R Sbjct: 3 YIQQVAVGRLPELNVYGHDYPTKDGSAIR 31 >XP_013654499.1 PREDICTED: bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1-like [Brassica napus] Length = 142 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPT DGSAVR Sbjct: 3 YIQQVAVGRLPELNVYGHDYPTEDGSAVR 31 >ONM56633.1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 [Zea mays] Length = 186 Score = 62.4 bits (150), Expect = 6e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDG+A+R Sbjct: 45 YIQQVAVGRLPELNVYGHDYPTRDGTAIR 73 >JAT43004.1 UDP-glucose 4-epimerase 1 [Anthurium amnicola] Length = 355 Score = 63.9 bits (154), Expect = 7e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSAVR Sbjct: 214 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 242 >KRH41130.1 hypothetical protein GLYMA_08G011800 [Glycine max] Length = 323 Score = 63.5 bits (153), Expect = 9e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >KRH41128.1 hypothetical protein GLYMA_08G011800 [Glycine max] Length = 339 Score = 63.5 bits (153), Expect = 9e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 200 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 228 >KYP45152.1 UDP-glucose 4-epimerase [Cajanus cajan] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >XP_014510518.1 PREDICTED: bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 [Vigna radiata var. radiata] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >KOM57075.1 hypothetical protein LR48_Vigan11g010700 [Vigna angularis] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >Q43070.1 RecName: Full=UDP-glucose 4-epimerase; AltName: Full=Galactowaldenase; AltName: Full=UDP-galactose 4-epimerase AAA86532.1 UDP-galactose-4-epimerase [Pisum sativum] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >XP_004503750.1 PREDICTED: bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 [Cicer arietinum] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >XP_003532591.1 PREDICTED: bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1-like [Glycine max] KHN16848.1 UDP-glucose 4-epimerase [Glycine soja] KRH41129.1 hypothetical protein GLYMA_08G011800 [Glycine max] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >B0M3E8.2 RecName: Full=Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1; AltName: Full=UDP-D-xylose 4-epimerase; AltName: Full=UDP-L-arabinose 4-epimerase; AltName: Full=UDP-galactose 4-epimerase 1; AltName: Full=UDP-glucose 4-epimerase 1; Short=PsUGE1 BAG09236.2 UDP-glucose 4-epimerase [Pisum sativum] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >XP_019072767.1 PREDICTED: bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 [Vitis vinifera] CBI34731.3 unnamed protein product, partial [Vitis vinifera] Length = 350 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 211 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 239 >AFK43339.1 unknown [Lotus japonicus] Length = 353 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 214 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 242 >XP_017441371.1 PREDICTED: bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 [Vigna angularis] Length = 379 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 240 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 268 >BAT73112.1 hypothetical protein VIGAN_01057100 [Vigna angularis var. angularis] Length = 381 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPTRDGSA+R Sbjct: 240 YIQQVAVGRLPELNVYGHDYPTRDGSAIR 268 >KJB25715.1 hypothetical protein B456_004G209200 [Gossypium raimondii] KJB25717.1 hypothetical protein B456_004G209200 [Gossypium raimondii] Length = 224 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 525 YIQQVAVGRLPELNVYGHDYPTRDGSAVR 439 YIQQVAVGRLPELNVYGHDYPT+DGSA+R Sbjct: 84 YIQQVAVGRLPELNVYGHDYPTKDGSAIR 112