BLASTX nr result
ID: Glycyrrhiza29_contig00021757
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021757 (219 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU29900.1 hypothetical protein TSUD_379900 [Trifolium subterran... 66 2e-11 GAU35861.1 hypothetical protein TSUD_63510 [Trifolium subterraneum] 56 2e-07 >GAU29900.1 hypothetical protein TSUD_379900 [Trifolium subterraneum] Length = 250 Score = 66.2 bits (160), Expect = 2e-11 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 94 SGLWCLAGDFNQVLFDWEKNGGGPINAAARDAFSSCIDSYHL 219 SG WC+AGDFNQVLFD +K GGGP+N+ R AF +CIDS L Sbjct: 156 SGPWCVAGDFNQVLFDHKKQGGGPVNSIGRSAFQACIDSCQL 197 >GAU35861.1 hypothetical protein TSUD_63510 [Trifolium subterraneum] Length = 483 Score = 56.2 bits (134), Expect = 2e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 85 ASHSGLWCLAGDFNQVLFDWEKNGGGPINAAARDAFSSCIDSYHL 219 AS SG WCLAGDFN VL+D EK GG P+N + ++F+SC+ +L Sbjct: 4 ASVSGPWCLAGDFNIVLYDREKTGGAPVNQRSVNSFASCLADCNL 48