BLASTX nr result
ID: Glycyrrhiza29_contig00021684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021684 (574 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KGN55084.1 hypothetical protein Csa_4G628320 [Cucumis sativus] 78 9e-15 NP_054981.1 hypothetical protein SpolCp077 (plastid) [Spinacia o... 74 2e-14 KVH89157.1 hypothetical protein Ccrd_008862, partial [Cynara car... 70 2e-12 AAO18644.1 hypothetical protein (chloroplast) [Lactuca sativa] A... 67 2e-11 YP_001109551.1 hypothetical protein Poptr_cp073 [Populus trichoc... 64 3e-10 NP_043078.1 hypothetical protein ZemaCp077 (chloroplast) [Zea ma... 63 5e-10 YP_024329.1 hypothetical protein 85 [Saccharum hybrid cultivar S... 62 2e-09 YP_052804.1 hypothetical protein OrniCp078 (chloroplast) [Oryza ... 61 2e-09 YP_009192343.1 hypothetical protein EC1Cp_p082 (chloroplast) [Ec... 61 3e-09 GAV61796.1 hypothetical protein CFOL_v3_05322, partial [Cephalot... 60 2e-08 XP_010094784.1 hypothetical protein L484_000755 [Morus notabilis... 59 7e-08 NP_039455.1 hypothetical protein OrsajCp100 [Oryza sativa Japoni... 54 2e-06 KQL10016.1 hypothetical protein SETIT_008430mg, partial [Setaria... 53 3e-06 NP_054551.1 hypothetical protein NitaCp077 [Nicotiana tabacum] N... 52 5e-06 >KGN55084.1 hypothetical protein Csa_4G628320 [Cucumis sativus] Length = 162 Score = 77.8 bits (190), Expect = 9e-15 Identities = 49/113 (43%), Positives = 58/113 (51%), Gaps = 1/113 (0%) Frame = +1 Query: 61 KEFVNFAGSRRGVETHNNS*IEIEK-CNSSYFGNGKIFGERTQEEGXXXXXXXXXXXXXX 237 ++ V+F+GSRRGVETH NS +E+EK CNSS FGN Sbjct: 92 RKVVHFSGSRRGVETHKNSGMEMEKRCNSSSFGN-------------------------- 125 Query: 238 XXXXEEYRVGFFSYPYRIEHVEPNLLHGKPTLFRPGKSYGFIKS*AIAQIRSQ 396 EH EPNLLH KP LFR GKSYGF+K A+A+IRSQ Sbjct: 126 ------------------EHAEPNLLHVKPALFRSGKSYGFMKPCAMARIRSQ 160 >NP_054981.1 hypothetical protein SpolCp077 (plastid) [Spinacia oleracea] NP_054998.1 hypothetical protein SpolCp096 (plastid) [Spinacia oleracea] CAB88777.1 hypothetical protein (chloroplast) [Spinacia oleracea] CAB88794.1 hypothetical protein (chloroplast) [Spinacia oleracea] Length = 54 Score = 73.9 bits (180), Expect = 2e-14 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = -2 Query: 441 GKIGFNCQLLLSKIGLTTDLSNSS*FDKTV*FSRSK*SGFSVKKIWLNMFYSI 283 GK GFNCQLLLS+IG TTDL++S+ F K+V FSRSK S F +KKIWL MFY I Sbjct: 2 GKFGFNCQLLLSEIGFTTDLNHSTCFHKSVRFSRSKSSRFYMKKIWLGMFYLI 54 >KVH89157.1 hypothetical protein Ccrd_008862, partial [Cynara cardunculus var. scolymus] Length = 90 Score = 69.7 bits (169), Expect = 2e-12 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -2 Query: 420 QLLLSKIGLTTDLSNSS*FDKTV*FSRSK*SGFSVKKIWLNMFYSIRVGEEPD 262 QL LS+IGLTTD S+S+ F KT FSRSK S F +KKIWL++FYSIR+ EEPD Sbjct: 2 QLSLSEIGLTTDSSHSTWFHKTTRFSRSKSSKFYMKKIWLSVFYSIRIEEEPD 54 >AAO18644.1 hypothetical protein (chloroplast) [Lactuca sativa] AAY57522.1 unknown (chloroplast) [Lactuca sativa] Length = 99 Score = 67.4 bits (163), Expect = 2e-11 Identities = 43/83 (51%), Positives = 50/83 (60%), Gaps = 1/83 (1%) Frame = +2 Query: 44 ICVPKKRNLSILQGLEGAWKHIITLELK*K-NVTLVTSEMVRFLAKERKKRGXXXXXXXX 220 +CVPKKRNL I + L+GAWKHI TLE K K + T V SEMVR LA+++ Sbjct: 23 VCVPKKRNLYIFRDLKGAWKHIRTLEWKWKRDGTPVPSEMVRSLAQKK------GLIRII 76 Query: 221 XXXXIF*EFLKNTESGSSPTRIE 289 F F NT SGSSPTRIE Sbjct: 77 LTWFCFLYFFNNTGSGSSPTRIE 99 >YP_001109551.1 hypothetical protein Poptr_cp073 [Populus trichocarpa] YP_001109568.1 hypothetical protein Poptr_cp090 [Populus trichocarpa] ABO36755.1 conserved hypothetical protein (chloroplast) [Populus trichocarpa] ABO36772.1 conserved hypothetical protein (chloroplast) [Populus trichocarpa] Length = 86 Score = 63.9 bits (154), Expect = 3e-10 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +2 Query: 44 ICVPKKRNLSILQGLEGAWKHIITLELK*K-NVTLVTSEMVRFLAKE 181 +CVPKKRNLSI +GL+GAWKHI TLE K K +VT V SEMVR LA+E Sbjct: 23 VCVPKKRNLSIFRGLKGAWKHIRTLEWKWKRDVTPVPSEMVRSLAQE 69 >NP_043078.1 hypothetical protein ZemaCp077 (chloroplast) [Zea mays] NP_043099.1 hypothetical protein ZemaCp098 (chloroplast) [Zea mays] Q36997.1 RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 CAA60340.1 hypothetical protein (chloroplast) [Zea mays] CAA60360.1 hypothetical protein (chloroplast) [Zea mays] Length = 85 Score = 63.2 bits (152), Expect = 5e-10 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 1/76 (1%) Frame = -2 Query: 318 VKKIWLNMFYSIRVGEEPDSVFFKNS*KIEKSELSQDDTDQPLFLRSFAKNLTISEVTRV 139 +KKI +MFYSI VGEEPDSVF K K + ++ + S AK+LTISE T Sbjct: 1 MKKILFSMFYSILVGEEPDSVFLKKEGKQNQVKMIW------IAPSSCAKDLTISEGTGA 54 Query: 138 TF-FYFNSRVIMCFHA 94 TF F+F+SRV +CFHA Sbjct: 55 TFPFHFHSRVSICFHA 70 >YP_024329.1 hypothetical protein 85 [Saccharum hybrid cultivar SP-80-3280] YP_024350.1 hypothetical protein 85 [Saccharum hybrid cultivar SP-80-3280] YP_054686.1 hypothetical protein SaofCp080 (chloroplast) [Saccharum hybrid cultivar NCo 310] YP_054707.1 hypothetical protein SaofCp101 (chloroplast) [Saccharum hybrid cultivar NCo 310] YP_003208241.1 hypothetical protein ColajoC_p079 (chloroplast) [Coix lacryma-jobi] YP_003208260.1 hypothetical protein ColajoC_p098 (chloroplast) [Coix lacryma-jobi] YP_009192464.1 hypothetical protein MsaCp_p081 (chloroplast) [Miscanthus sacchariflorus] YP_009192489.1 hypothetical protein MsaCp_p106 (chloroplast) [Miscanthus sacchariflorus] YP_009192586.1 hypothetical protein MsiCp_p081 (chloroplast) [Miscanthus sinensis] YP_009192611.1 hypothetical protein MsiCp_p106 (chloroplast) [Miscanthus sinensis] Q6ENQ6.1 RecName: Full=Uncharacterized protein ycf76 Q6L3C8.1 RecName: Full=Uncharacterized protein ycf76 AAT44644.1 hypothetical protein 85 (chloroplast) [Saccharum hybrid cultivar SP80-3280] AAT44665.1 hypothetical protein 85 (chloroplast) [Saccharum hybrid cultivar SP80-3280] BAD27350.1 hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] BAD27371.1 hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] ACI43246.1 unknown (chloroplast) [Coix lacryma-jobi] ACI43253.1 unknown (chloroplast) [Coix lacryma-jobi] ALP29691.1 hypothetical protein MsaCp_p081 (chloroplast) [Miscanthus sacchariflorus] ALP29716.1 hypothetical protein MsaCp_p106 (chloroplast) [Miscanthus sacchariflorus] ALP29813.1 hypothetical protein MsiCp_p081 (chloroplast) [Miscanthus sinensis] ALP29838.1 hypothetical protein MsiCp_p106 (chloroplast) [Miscanthus sinensis] Length = 85 Score = 61.6 bits (148), Expect = 2e-09 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = -2 Query: 318 VKKIWLNMFYSIRVGEEPDSVFFKNS*KIEKSELSQDDTDQPLFLRSFAKNLTISEVTRV 139 +KKI +MFYSI VGEEPDSVF K K + ++ + S AK+LTISE T Sbjct: 1 MKKILFSMFYSILVGEEPDSVFLKKEGKQNQVKMIW------IAPSSCAKDLTISEGTGA 54 Query: 138 TF-FYFNSRVIMCFHA 94 TF F F+SRV +CFHA Sbjct: 55 TFLFNFHSRVSICFHA 70 >YP_052804.1 hypothetical protein OrniCp078 (chloroplast) [Oryza nivara] YP_052828.1 hypothetical protein OrniCp102 (chloroplast) [Oryza nivara] Q6EN94.1 RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF72 BAD26834.1 unnamed protein product (chloroplast) [Oryza nivara] BAD26858.1 unnamed protein product (chloroplast) [Oryza nivara] AGY48998.1 hypothetical protein Ycf76 (chloroplast) [Oryza rufipogon] AGY49024.1 hypothetical protein Ycf76 (chloroplast) [Oryza rufipogon] Length = 72 Score = 61.2 bits (147), Expect = 2e-09 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = -2 Query: 318 VKKIWLNMFYSIRVGEEPDSVFFKNS*KIEKSELSQDDTDQPLFLRSFAKNLTISEVTRV 139 +KKI +MFYSI VGEEPDSVF K K + ++ + S AK+LTISE T Sbjct: 1 MKKILFSMFYSILVGEEPDSVFLKKEGKQNQVKMIW------VAPSSCAKDLTISEGTGA 54 Query: 138 TF-FYFNSRVIMCFHA 94 TF F F+SRV +CFHA Sbjct: 55 TFLFNFHSRVSICFHA 70 >YP_009192343.1 hypothetical protein EC1Cp_p082 (chloroplast) [Echinochloa crus-galli] YP_009192366.1 hypothetical protein EC1Cp_p105 (chloroplast) [Echinochloa crus-galli] ALP29326.1 hypothetical protein EC1Cp_p082 (chloroplast) [Echinochloa crus-galli] ALP29349.1 hypothetical protein EC1Cp_p105 (chloroplast) [Echinochloa crus-galli] ALP29448.1 hypothetical protein EC2Cp_p082 (chloroplast) [Echinochloa crus-galli var. crus-galli] ALP29471.1 hypothetical protein EC2Cp_p105 (chloroplast) [Echinochloa crus-galli var. crus-galli] ALP29570.1 hypothetical protein EC3Cp_p082 (chloroplast) [Echinochloa crus-galli var. praticola] ALP29593.1 hypothetical protein EC3Cp_p105 (chloroplast) [Echinochloa crus-galli var. praticola] Length = 85 Score = 61.2 bits (147), Expect = 3e-09 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = -2 Query: 318 VKKIWLNMFYSIRVGEEPDSVFFKNS*KIEKSELSQDDTDQPLFLRSFAKNLTISEVTRV 139 +KKI +MFYSI VGEEPDSVF K K + ++ + S AK+LTISE T Sbjct: 1 MKKILFSMFYSILVGEEPDSVFLKKEGKQNQVKMIW------VAPSSCAKDLTISEGTGA 54 Query: 138 TF-FYFNSRVIMCFHA 94 TF F F+SRV +CFHA Sbjct: 55 TFLFNFHSRVSICFHA 70 >GAV61796.1 hypothetical protein CFOL_v3_05322, partial [Cephalotus follicularis] Length = 102 Score = 59.7 bits (143), Expect = 2e-08 Identities = 33/47 (70%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 50 VPKKRNLSILQGLEGAWKHIITLELK*K-NVTLVTSEMVRFLAKERK 187 VPKKRNLSI +GL+GAWKHI TLE K K +VT V SEMVR LA+E + Sbjct: 41 VPKKRNLSIFRGLKGAWKHIRTLEWKWKRDVTPVPSEMVRSLAQEEE 87 >XP_010094784.1 hypothetical protein L484_000755 [Morus notabilis] EXB56973.1 hypothetical protein L484_000755 [Morus notabilis] Length = 153 Score = 59.3 bits (142), Expect = 7e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 301 EPNLLHGKPTLFRPGKSYGFIKS*AIAQIRSQSYFR 408 EPNLLH KP LFR GKSYGF+K A+A+IRSQSYFR Sbjct: 118 EPNLLHVKPALFRSGKSYGFMKPCAMARIRSQSYFR 153 >NP_039455.1 hypothetical protein OrsajCp100 [Oryza sativa Japonica Group] Q32766.1 RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 P0C472.1 RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 P0C471.1 RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 CAA33916.1 unnamed protein product (chloroplast) [Oryza sativa Japonica Group] prf||1603356DF ORF 85B [Oryza sativa] Length = 85 Score = 53.5 bits (127), Expect = 2e-06 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 1/77 (1%) Frame = -2 Query: 318 VKKIWLNMFYSIRVGEEPDSVFFKNS*KIEKSELSQDDTDQPLFLRSFAKNLTISEVTRV 139 +KKI +MFYSI VGEEPDSVF K K + ++ + S AK+LTISE T Sbjct: 1 MKKILFSMFYSILVGEEPDSVFLKKEGKQNQVKMIW------VAPSSCAKDLTISEGTGA 54 Query: 138 TF-FYFNSRVIMCFHAP 91 TF F F+SRV F P Sbjct: 55 TFLFNFHSRVSYLFPRP 71 >KQL10016.1 hypothetical protein SETIT_008430mg, partial [Setaria italica] Length = 66 Score = 52.8 bits (125), Expect = 3e-06 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = -2 Query: 318 VKKIWLNMFYSIRVGEEPDSVFFKNS*KIEKSELSQDDTDQPLFLRSFAKNLTISEVTRV 139 +KKI +MFYSI VGEEPDS+F K K + ++ + S AK+LTISE T Sbjct: 1 MKKILFSMFYSILVGEEPDSIFLKKEGKQNQVKMIW------VAPSSCAKDLTISEGTGA 54 Query: 138 TFFY-FNSRV 112 TFF+ F+SRV Sbjct: 55 TFFFNFHSRV 64 >NP_054551.1 hypothetical protein NitaCp077 [Nicotiana tabacum] NP_054567.1 hypothetical protein NitaCp093 [Nicotiana tabacum] YP_358730.1 hypothetical protein NisyCp086 [Nicotiana sylvestris] YP_358749.1 hypothetical protein NisyCp107 [Nicotiana sylvestris] YP_398916.1 hypothetical protein NitoCp085 [Nicotiana tomentosiformis] YP_398935.1 hypothetical protein NitoCp106 [Nicotiana tomentosiformis] YP_004891659.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891678.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA77391.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77402.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46707.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46726.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48056.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48075.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95617.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95635.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95726.1 hypothetical protein [synthetic construct] AEO95743.1 hypothetical protein [synthetic construct] prf||1211235CJ ORF 70B Length = 70 Score = 52.4 bits (124), Expect = 5e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 44 ICVPKKRNLSILQGLEGAWKHIITLELK*KNVTLVTSEMV 163 +CVPKKRNLSI +GL+GAWK I TLE K ++VT V SE V Sbjct: 23 VCVPKKRNLSIFRGLKGAWKRIRTLEWK-RDVTPVPSESV 61