BLASTX nr result
ID: Glycyrrhiza29_contig00021671
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021671 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019413982.1 PREDICTED: kunitz-type trypsin inhibitor-like 2 p... 55 4e-07 GAU45377.1 hypothetical protein TSUD_89970 [Trifolium subterraneum] 51 8e-06 >XP_019413982.1 PREDICTED: kunitz-type trypsin inhibitor-like 2 protein [Lupinus angustifolius] OIV98953.1 hypothetical protein TanjilG_07388 [Lupinus angustifolius] Length = 216 Score = 54.7 bits (130), Expect = 4e-07 Identities = 28/44 (63%), Positives = 32/44 (72%), Gaps = 4/44 (9%) Frame = -3 Query: 236 CVDIGRY----DDENGRRLVLTDEGPFAVVFVDADFTPGISSVV 117 C+DIGRY DDE GRRL LT+ PF +VFVDA F+ GI SVV Sbjct: 173 CLDIGRYKNENDDEGGRRLNLTEHEPFELVFVDAGFSSGIKSVV 216 >GAU45377.1 hypothetical protein TSUD_89970 [Trifolium subterraneum] Length = 216 Score = 51.2 bits (121), Expect = 8e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -3 Query: 239 VCVDIGRYDDENGRRLVLTDEGPFAVVFVDAD 144 +C DIGRY DENGRRL+LT++ PF +VFV D Sbjct: 176 LCFDIGRYSDENGRRLILTEKNPFEIVFVITD 207