BLASTX nr result
ID: Glycyrrhiza29_contig00021628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021628 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003594635.2 hypothetical protein MTR_2g032740 [Medicago trunc... 64 1e-09 XP_003594643.1 transmembrane protein, putative [Medicago truncat... 60 2e-08 XP_003594634.1 hypothetical protein MTR_2g032720 [Medicago trunc... 57 3e-07 >XP_003594635.2 hypothetical protein MTR_2g032740 [Medicago truncatula] AES64886.2 hypothetical protein MTR_2g032740 [Medicago truncatula] Length = 345 Score = 63.5 bits (153), Expect = 1e-09 Identities = 35/65 (53%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +1 Query: 1 PQFFMHLANNLELVKLEPWRFPTLIAVARELESGHNGCSTVADSEAT--LAPNPTTVLAL 174 PQFFM+LA + K+EP RFPTLIAVA+EL+ N CSTVA+ E T + + TV L Sbjct: 271 PQFFMYLAPKEAMSKVEPSRFPTLIAVAQELQRKDNNCSTVAELELTSMVGEDLETVKDL 330 Query: 175 VELHR 189 V++HR Sbjct: 331 VKIHR 335 >XP_003594643.1 transmembrane protein, putative [Medicago truncatula] AES64894.1 transmembrane protein, putative [Medicago truncatula] Length = 344 Score = 60.1 bits (144), Expect = 2e-08 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 2/64 (3%) Frame = +1 Query: 1 PQFFMHLANNLELVKLEPWRFPTLIAVARELESGHNGCSTVADSEATLAP--NPTTVLAL 174 PQFFM +A+ + L K+EP +FPTLIAVA+ELE CS AD E T +PT + AL Sbjct: 273 PQFFMCVASKVALSKVEPSQFPTLIAVAQELEKKVKNCSVGADCELTSTDGVDPTMIQAL 332 Query: 175 VELH 186 V+ H Sbjct: 333 VKFH 336 >XP_003594634.1 hypothetical protein MTR_2g032720 [Medicago truncatula] AES64885.1 hypothetical protein MTR_2g032720 [Medicago truncatula] Length = 398 Score = 57.0 bits (136), Expect = 3e-07 Identities = 36/104 (34%), Positives = 56/104 (53%), Gaps = 3/104 (2%) Frame = +1 Query: 1 PQFFMHLANNLELVKLEPWRFPTLIAVARELE-SGHNGCSTVADSEATLAPNPTTVLALV 177 PQFFM + +N+E K+EP FPTL+AVA+ELE + +N S +T NP V +LV Sbjct: 249 PQFFMCMVSNVERYKVEPSLFPTLLAVAQELERADYNNNVANFKSISTTDANPAIVQSLV 308 Query: 178 ELHR--ITTVADLRCKMKNNNVPPSSESKLNRLSVIKMKEIRAE 303 LH+ ++ + V K +R S ++M +++ E Sbjct: 309 TLHQTAFPQHGSSSSNVRRSQVKQEKPQKRSRTSNVQMPQVKRE 352