BLASTX nr result
ID: Glycyrrhiza29_contig00021562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021562 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004515244.1 PREDICTED: pentatricopeptide repeat-containing pr... 165 2e-46 KOM54546.1 hypothetical protein LR48_Vigan10g043800 [Vigna angul... 162 7e-46 XP_006599726.1 PREDICTED: pentatricopeptide repeat-containing pr... 163 1e-45 KRH09493.1 hypothetical protein GLYMA_16G218600 [Glycine max] KR... 163 2e-45 GAU28138.1 hypothetical protein TSUD_295770 [Trifolium subterran... 161 2e-45 EEF40500.1 pentatricopeptide repeat-containing protein, putative... 159 2e-45 XP_017437816.1 PREDICTED: pentatricopeptide repeat-containing pr... 162 3e-45 BAU02627.1 hypothetical protein VIGAN_11218200 [Vigna angularis ... 162 3e-45 XP_013452779.1 PPR containing plant-like protein [Medicago trunc... 160 3e-45 XP_015966829.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 4e-45 XP_007152610.1 hypothetical protein PHAVU_004G144600g [Phaseolus... 161 6e-45 XP_014507236.1 PREDICTED: pentatricopeptide repeat-containing pr... 161 7e-45 XP_015576449.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 159 7e-45 XP_016203342.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 1e-44 XP_002315827.2 pentatricopeptide repeat-containing family protei... 157 3e-44 XP_015951651.1 PREDICTED: pentatricopeptide repeat-containing pr... 157 3e-44 XP_016181081.1 PREDICTED: pentatricopeptide repeat-containing pr... 159 4e-44 OAY29401.1 hypothetical protein MANES_15G142300 [Manihot esculenta] 158 6e-44 KRH38972.1 hypothetical protein GLYMA_09G169000 [Glycine max] 158 7e-44 XP_014617702.1 PREDICTED: pentatricopeptide repeat-containing pr... 158 8e-44 >XP_004515244.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Cicer arietinum] Length = 614 Score = 165 bits (417), Expect = 2e-46 Identities = 79/85 (92%), Positives = 83/85 (97%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCDVL+YMKRNNK+TVP+EVLL ILRKYTEKYLTHVQKFAKKK Sbjct: 210 MMDILSSTKYKVKQFRIVCDVLDYMKRNNKSTVPAEVLLNILRKYTEKYLTHVQKFAKKK 269 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 R+RVKTQPEINAFN LLDALCKCCL Sbjct: 270 RVRVKTQPEINAFNFLLDALCKCCL 294 >KOM54546.1 hypothetical protein LR48_Vigan10g043800 [Vigna angularis] Length = 519 Score = 162 bits (410), Expect = 7e-46 Identities = 79/85 (92%), Positives = 83/85 (97%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCD+LEYMKRN+K TVP EVL+TILRKYTEKYLTHVQKFAKK+ Sbjct: 116 MMDILSSTKYKVKQFRIVCDMLEYMKRNDKITVPVEVLMTILRKYTEKYLTHVQKFAKKR 175 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 176 RIRVKTQPEINAFNLLLDALCKCCL 200 >XP_006599726.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Glycine max] XP_003548320.2 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Glycine max] KRH09497.1 hypothetical protein GLYMA_16G218600 [Glycine max] Length = 591 Score = 163 bits (412), Expect = 1e-45 Identities = 79/85 (92%), Positives = 82/85 (96%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSST+YKVKQFRIVCDVLEYMKRNNK TVP EVLL ILRKYTEKYLTHVQKFA+K+ Sbjct: 188 MMDILSSTRYKVKQFRIVCDVLEYMKRNNKTTVPVEVLLVILRKYTEKYLTHVQKFARKR 247 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 248 RIRVKTQPEINAFNLLLDALCKCCL 272 >KRH09493.1 hypothetical protein GLYMA_16G218600 [Glycine max] KRH09494.1 hypothetical protein GLYMA_16G218600 [Glycine max] KRH09495.1 hypothetical protein GLYMA_16G218600 [Glycine max] KRH09496.1 hypothetical protein GLYMA_16G218600 [Glycine max] Length = 635 Score = 163 bits (412), Expect = 2e-45 Identities = 79/85 (92%), Positives = 82/85 (96%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSST+YKVKQFRIVCDVLEYMKRNNK TVP EVLL ILRKYTEKYLTHVQKFA+K+ Sbjct: 232 MMDILSSTRYKVKQFRIVCDVLEYMKRNNKTTVPVEVLLVILRKYTEKYLTHVQKFARKR 291 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 292 RIRVKTQPEINAFNLLLDALCKCCL 316 >GAU28138.1 hypothetical protein TSUD_295770 [Trifolium subterraneum] Length = 523 Score = 161 bits (407), Expect = 2e-45 Identities = 76/85 (89%), Positives = 82/85 (96%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCDVL+YMKRNNK+ +P+E+LL ILRKYTEKYLTHVQKFAK+K Sbjct: 119 MMDILSSTKYKVKQFRIVCDVLDYMKRNNKSKIPAEILLNILRKYTEKYLTHVQKFAKRK 178 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFN LLDALCKCCL Sbjct: 179 RIRVKTQPEINAFNFLLDALCKCCL 203 >EEF40500.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 428 Score = 159 bits (402), Expect = 2e-45 Identities = 78/85 (91%), Positives = 81/85 (95%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCD+L+YMKRNNKN VP EVLLTILR YT+KYLTHVQKFAKKK Sbjct: 112 MMDILSSTKYKVKQFRIVCDMLDYMKRNNKNIVPVEVLLTILRNYTQKYLTHVQKFAKKK 171 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKC L Sbjct: 172 RIRVKTQPEINAFNLLLDALCKCSL 196 >XP_017437816.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna angularis] XP_017437817.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna angularis] Length = 614 Score = 162 bits (410), Expect = 3e-45 Identities = 79/85 (92%), Positives = 83/85 (97%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCD+LEYMKRN+K TVP EVL+TILRKYTEKYLTHVQKFAKK+ Sbjct: 211 MMDILSSTKYKVKQFRIVCDMLEYMKRNDKITVPVEVLMTILRKYTEKYLTHVQKFAKKR 270 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 271 RIRVKTQPEINAFNLLLDALCKCCL 295 >BAU02627.1 hypothetical protein VIGAN_11218200 [Vigna angularis var. angularis] Length = 617 Score = 162 bits (410), Expect = 3e-45 Identities = 79/85 (92%), Positives = 83/85 (97%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCD+LEYMKRN+K TVP EVL+TILRKYTEKYLTHVQKFAKK+ Sbjct: 211 MMDILSSTKYKVKQFRIVCDMLEYMKRNDKITVPVEVLMTILRKYTEKYLTHVQKFAKKR 270 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 271 RIRVKTQPEINAFNLLLDALCKCCL 295 >XP_013452779.1 PPR containing plant-like protein [Medicago truncatula] KEH26807.1 PPR containing plant-like protein [Medicago truncatula] Length = 524 Score = 160 bits (406), Expect = 3e-45 Identities = 77/85 (90%), Positives = 82/85 (96%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSST+YKVKQFRIVCDVLEYMKRNNK+TVP +VL+ ILRKYTEKYLTHVQKFAK+K Sbjct: 120 MMDILSSTRYKVKQFRIVCDVLEYMKRNNKSTVPVDVLMDILRKYTEKYLTHVQKFAKRK 179 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFN LLDALCKCCL Sbjct: 180 RIRVKTQPEINAFNFLLDALCKCCL 204 >XP_015966829.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis duranensis] XP_015966830.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis duranensis] XP_015966831.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis duranensis] XP_015966832.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis duranensis] Length = 504 Score = 160 bits (404), Expect = 4e-45 Identities = 78/85 (91%), Positives = 81/85 (95%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILS TKYK KQFRIVCD+LEYMKR+NKNTVP EVLLTILR+YTEKYLT VQKFAKKK Sbjct: 101 MMDILSCTKYKTKQFRIVCDMLEYMKRHNKNTVPVEVLLTILRRYTEKYLTRVQKFAKKK 160 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 161 RIRVKTQPEINAFNLLLDALCKCCL 185 >XP_007152610.1 hypothetical protein PHAVU_004G144600g [Phaseolus vulgaris] ESW24604.1 hypothetical protein PHAVU_004G144600g [Phaseolus vulgaris] Length = 597 Score = 161 bits (407), Expect = 6e-45 Identities = 78/85 (91%), Positives = 82/85 (96%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCD+LEYMKRNNK VP+EVL+ ILRKYTEKYLTHVQKFAKK+ Sbjct: 194 MMDILSSTKYKVKQFRIVCDMLEYMKRNNKIAVPAEVLMMILRKYTEKYLTHVQKFAKKR 253 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 254 RIRVKTQPEINAFNLLLDALCKCCL 278 >XP_014507236.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507312.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507388.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507465.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507537.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507613.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] Length = 614 Score = 161 bits (407), Expect = 7e-45 Identities = 78/85 (91%), Positives = 83/85 (97%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCD+LEYMKRN+K TVP EVL+TILRKYTEKYLTHVQKFAKK+ Sbjct: 211 MMDILSSTKYKVKQFRIVCDMLEYMKRNDKITVPVEVLMTILRKYTEKYLTHVQKFAKKR 270 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RI+VKTQPEINAFNLLLDALCKCCL Sbjct: 271 RIKVKTQPEINAFNLLLDALCKCCL 295 >XP_015576449.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Ricinus communis] Length = 491 Score = 159 bits (402), Expect = 7e-45 Identities = 78/85 (91%), Positives = 81/85 (95%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSSTKYKVKQFRIVCD+L+YMKRNNKN VP EVLLTILR YT+KYLTHVQKFAKKK Sbjct: 153 MMDILSSTKYKVKQFRIVCDMLDYMKRNNKNIVPVEVLLTILRNYTQKYLTHVQKFAKKK 212 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKC L Sbjct: 213 RIRVKTQPEINAFNLLLDALCKCSL 237 >XP_016203342.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis ipaensis] Length = 563 Score = 160 bits (404), Expect = 1e-44 Identities = 78/85 (91%), Positives = 81/85 (95%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILS TKYK KQFRIVCD+LEYMKR+NKNTVP EVLLTILR+YTEKYLT VQKFAKKK Sbjct: 160 MMDILSCTKYKTKQFRIVCDMLEYMKRHNKNTVPVEVLLTILRRYTEKYLTRVQKFAKKK 219 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 220 RIRVKTQPEINAFNLLLDALCKCCL 244 >XP_002315827.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEF01998.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 472 Score = 157 bits (397), Expect = 3e-44 Identities = 76/85 (89%), Positives = 80/85 (94%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 M+DIL+STKYK KQFRIVCD+L+YMKRNNKN VP EVLLTILR YTEKYLT VQKFAKKK Sbjct: 69 MIDILTSTKYKAKQFRIVCDMLDYMKRNNKNVVPVEVLLTILRNYTEKYLTRVQKFAKKK 128 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 129 RIRVKTQPEINAFNLLLDALCKCCL 153 >XP_015951651.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis duranensis] Length = 493 Score = 157 bits (398), Expect = 3e-44 Identities = 77/85 (90%), Positives = 80/85 (94%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILS TKYK KQFRIVCD+LEYMKR+NKNTVP EVLLTILR+YTEKYLT VQK AKKK Sbjct: 184 MMDILSCTKYKTKQFRIVCDMLEYMKRHNKNTVPVEVLLTILRRYTEKYLTRVQKLAKKK 243 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 244 RIRVKTQPEINAFNLLLDALCKCCL 268 >XP_016181081.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis ipaensis] XP_016181082.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis ipaensis] XP_016181083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis ipaensis] XP_016181084.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis ipaensis] XP_016181085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Arachis ipaensis] Length = 586 Score = 159 bits (401), Expect = 4e-44 Identities = 77/85 (90%), Positives = 81/85 (95%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILS TKYK KQFRIVCD+LEYMKR+NKNTVP EV+LTILR+YTEKYLT VQKFAKKK Sbjct: 184 MMDILSCTKYKTKQFRIVCDMLEYMKRHNKNTVPVEVVLTILRRYTEKYLTRVQKFAKKK 243 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDALCKCCL Sbjct: 244 RIRVKTQPEINAFNLLLDALCKCCL 268 >OAY29401.1 hypothetical protein MANES_15G142300 [Manihot esculenta] Length = 576 Score = 158 bits (399), Expect = 6e-44 Identities = 75/85 (88%), Positives = 82/85 (96%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 M+DILS+TKYKVKQFRIVCD+L+YMKR+NKN VP EVLLTILR YT+KYLTHVQKFAKKK Sbjct: 170 MIDILSNTKYKVKQFRIVCDMLDYMKRSNKNVVPVEVLLTILRNYTQKYLTHVQKFAKKK 229 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQPEINAFNLLLDA+CKCCL Sbjct: 230 RIRVKTQPEINAFNLLLDAMCKCCL 254 >KRH38972.1 hypothetical protein GLYMA_09G169000 [Glycine max] Length = 589 Score = 158 bits (399), Expect = 7e-44 Identities = 77/85 (90%), Positives = 81/85 (95%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSST+YKVKQFRIVCDVLEYMKRNN+ VP+EVLL ILRKYTEKYLTH+QKFAKKK Sbjct: 186 MMDILSSTRYKVKQFRIVCDVLEYMKRNNRTMVPAEVLLVILRKYTEKYLTHMQKFAKKK 245 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQ EINAFNLLLDALCKCCL Sbjct: 246 RIRVKTQLEINAFNLLLDALCKCCL 270 >XP_014617702.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Glycine max] Length = 604 Score = 158 bits (399), Expect = 8e-44 Identities = 77/85 (90%), Positives = 81/85 (95%) Frame = +1 Query: 1 MMDILSSTKYKVKQFRIVCDVLEYMKRNNKNTVPSEVLLTILRKYTEKYLTHVQKFAKKK 180 MMDILSST+YKVKQFRIVCDVLEYMKRNN+ VP+EVLL ILRKYTEKYLTH+QKFAKKK Sbjct: 201 MMDILSSTRYKVKQFRIVCDVLEYMKRNNRTMVPAEVLLVILRKYTEKYLTHMQKFAKKK 260 Query: 181 RIRVKTQPEINAFNLLLDALCKCCL 255 RIRVKTQ EINAFNLLLDALCKCCL Sbjct: 261 RIRVKTQLEINAFNLLLDALCKCCL 285