BLASTX nr result
ID: Glycyrrhiza29_contig00021263
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021263 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP59461.1 hypothetical protein KK1_014897 [Cajanus cajan] 102 1e-24 XP_007139160.1 hypothetical protein PHAVU_008G006400g [Phaseolus... 102 2e-24 XP_019451387.1 PREDICTED: uncharacterized protein LOC109353527 [... 101 4e-24 KRH01746.1 hypothetical protein GLYMA_18G296200 [Glycine max] 101 4e-24 XP_016194766.1 PREDICTED: uncharacterized protein LOC107635723 [... 101 5e-24 XP_015962962.1 PREDICTED: uncharacterized protein LOC107486903 [... 101 5e-24 XP_006601736.1 PREDICTED: uncharacterized protein LOC100306005 i... 101 6e-24 NP_001236187.1 uncharacterized protein LOC100306005 [Glycine max... 101 7e-24 XP_003532344.1 PREDICTED: uncharacterized protein LOC100816181 [... 100 8e-24 KHN24930.1 hypothetical protein glysoja_027044 [Glycine soja] 100 9e-24 KHN17307.1 hypothetical protein glysoja_036912 [Glycine soja] 101 9e-24 XP_004492941.1 PREDICTED: uncharacterized protein LOC101512159 [... 100 1e-23 XP_003624336.1 peptidase M50B-like protein [Medicago truncatula]... 98 2e-22 AFK39037.1 unknown [Medicago truncatula] 97 2e-22 AFK33799.1 unknown [Lotus japonicus] 97 2e-22 GAU37781.1 hypothetical protein TSUD_158620 [Trifolium subterran... 97 2e-22 BAT82986.1 hypothetical protein VIGAN_04007800 [Vigna angularis ... 97 4e-22 XP_002283944.1 PREDICTED: uncharacterized protein LOC100253235 [... 96 6e-22 KVI02793.1 hypothetical protein Ccrd_018914 [Cynara cardunculus ... 94 1e-21 XP_014497282.1 PREDICTED: uncharacterized protein LOC106758806 [... 95 2e-21 >KYP59461.1 hypothetical protein KK1_014897 [Cajanus cajan] Length = 233 Score = 102 bits (255), Expect = 1e-24 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD+DQKVFIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDQDQKVFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >XP_007139160.1 hypothetical protein PHAVU_008G006400g [Phaseolus vulgaris] XP_007139161.1 hypothetical protein PHAVU_008G006400g [Phaseolus vulgaris] ESW11154.1 hypothetical protein PHAVU_008G006400g [Phaseolus vulgaris] ESW11155.1 hypothetical protein PHAVU_008G006400g [Phaseolus vulgaris] Length = 233 Score = 102 bits (254), Expect = 2e-24 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD DQKVFIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDHDQKVFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >XP_019451387.1 PREDICTED: uncharacterized protein LOC109353527 [Lupinus angustifolius] OIW07396.1 hypothetical protein TanjilG_10231 [Lupinus angustifolius] Length = 232 Score = 101 bits (252), Expect = 4e-24 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD DQKVFIACV AFTV+ILLLWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDYDQKVFIACVAAFTVLILLLWRTFLLTPFKLITVFLHEAS 51 >KRH01746.1 hypothetical protein GLYMA_18G296200 [Glycine max] Length = 224 Score = 101 bits (251), Expect = 4e-24 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQKVFIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKVFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >XP_016194766.1 PREDICTED: uncharacterized protein LOC107635723 [Arachis ipaensis] Length = 233 Score = 101 bits (251), Expect = 5e-24 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD+DQK+FIACV AFTVVI +LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDKDQKIFIACVAAFTVVIFVLWRTFLLTPFKLITVFLHEAS 51 >XP_015962962.1 PREDICTED: uncharacterized protein LOC107486903 [Arachis duranensis] Length = 233 Score = 101 bits (251), Expect = 5e-24 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD+DQK+FIACV AFTVVI +LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDKDQKIFIACVAAFTVVIFVLWRTFLLTPFKLITVFLHEAS 51 >XP_006601736.1 PREDICTED: uncharacterized protein LOC100306005 isoform X1 [Glycine max] KRH01745.1 hypothetical protein GLYMA_18G296200 [Glycine max] Length = 234 Score = 101 bits (251), Expect = 6e-24 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQKVFIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKVFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >NP_001236187.1 uncharacterized protein LOC100306005 [Glycine max] ACU13969.1 unknown [Glycine max] Length = 247 Score = 101 bits (251), Expect = 7e-24 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQKVFIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKVFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >XP_003532344.1 PREDICTED: uncharacterized protein LOC100816181 [Glycine max] KRH46934.1 hypothetical protein GLYMA_08G366100 [Glycine max] Length = 234 Score = 100 bits (250), Expect = 8e-24 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQK+FIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKIFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >KHN24930.1 hypothetical protein glysoja_027044 [Glycine soja] Length = 239 Score = 100 bits (250), Expect = 9e-24 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQK+FIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKIFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >KHN17307.1 hypothetical protein glysoja_036912 [Glycine soja] Length = 259 Score = 101 bits (251), Expect = 9e-24 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQKVFIACV AFTVVIL+LWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKVFIACVAAFTVVILVLWRTFLLTPFKLITVFLHEAS 51 >XP_004492941.1 PREDICTED: uncharacterized protein LOC101512159 [Cicer arietinum] Length = 233 Score = 100 bits (249), Expect = 1e-23 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD DQK+FIA VGAFTVVILLLWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDHDQKLFIAFVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 51 >XP_003624336.1 peptidase M50B-like protein [Medicago truncatula] AES80554.1 peptidase M50B-like protein [Medicago truncatula] Length = 247 Score = 97.8 bits (242), Expect = 2e-22 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD DQK+FIA VG +TVVILLLWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDHDQKLFIAFVGVYTVVILLLWRTFLLTPFKLITVFLHEAS 51 >AFK39037.1 unknown [Medicago truncatula] Length = 233 Score = 97.4 bits (241), Expect = 2e-22 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD DQK+FIA VG +TV+ILLLWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDHDQKLFIAFVGVYTVIILLLWRTFLLTPFKLITVFLHEAS 51 >AFK33799.1 unknown [Lotus japonicus] Length = 235 Score = 97.4 bits (241), Expect = 2e-22 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD DQKVF+ACV AFTVVIL+LWRT LLTPFK ITVFLHEAS Sbjct: 1 MPNWELKNCCDHDQKVFLACVAAFTVVILVLWRTVLLTPFKFITVFLHEAS 51 >GAU37781.1 hypothetical protein TSUD_158620 [Trifolium subterraneum] Length = 212 Score = 96.7 bits (239), Expect = 2e-22 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWELKNCCD DQK+FIA +G +TVVILLLWRTFLLTPFKLITVFLHEAS Sbjct: 1 MPNWELKNCCDHDQKLFIAFLGVYTVVILLLWRTFLLTPFKLITVFLHEAS 51 >BAT82986.1 hypothetical protein VIGAN_04007800 [Vigna angularis var. angularis] Length = 260 Score = 97.1 bits (240), Expect = 4e-22 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQKVFI CV FTVVIL+LWRTF+LTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKVFIGCVAGFTVVILVLWRTFVLTPFKLITVFLHEAS 51 >XP_002283944.1 PREDICTED: uncharacterized protein LOC100253235 [Vitis vinifera] CBI33640.3 unnamed protein product, partial [Vitis vinifera] Length = 233 Score = 95.9 bits (237), Expect = 6e-22 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 MANWELKNCC DQ VF+A +G FTVVILLLWRTFLLTPFKLITVFLHEAS Sbjct: 1 MANWELKNCCKHDQVVFLATIGVFTVVILLLWRTFLLTPFKLITVFLHEAS 51 >KVI02793.1 hypothetical protein Ccrd_018914 [Cynara cardunculus var. scolymus] Length = 200 Score = 94.4 bits (233), Expect = 1e-21 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +2 Query: 236 NWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 NWELK+CCDRDQK+F+A VG FT+VIL LWRTFLLTPFKLITVFLHEAS Sbjct: 4 NWELKDCCDRDQKLFLATVGIFTIVILALWRTFLLTPFKLITVFLHEAS 52 >XP_014497282.1 PREDICTED: uncharacterized protein LOC106758806 [Vigna radiata var. radiata] Length = 233 Score = 94.7 bits (234), Expect = 2e-21 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +2 Query: 230 MANWELKNCCDRDQKVFIACVGAFTVVILLLWRTFLLTPFKLITVFLHEAS 382 M NWEL+NCCD DQKVFI CV FTV+IL+LWRT LLTPFKLITVFLHEAS Sbjct: 1 MPNWELRNCCDHDQKVFIGCVAGFTVLILVLWRTILLTPFKLITVFLHEAS 51