BLASTX nr result
ID: Glycyrrhiza29_contig00021220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00021220 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH46939.1 hypothetical protein GLYMA_08G366500 [Glycine max] 72 4e-14 XP_007139167.1 hypothetical protein PHAVU_008G007000g [Phaseolus... 57 8e-09 >KRH46939.1 hypothetical protein GLYMA_08G366500 [Glycine max] Length = 94 Score = 71.6 bits (174), Expect = 4e-14 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = -1 Query: 158 VRMMNKNGIMVAHALGHKMTGSCCFHDCPLLVFGSPAFIIWTTTCKYIDFD 6 V++M+ N M AH LGHKMTG+CCF C L VF S AF++W T CKYIDFD Sbjct: 15 VKVMDTNDTMQAHVLGHKMTGNCCFRGCTLPVFCSSAFVLW-TMCKYIDFD 64 >XP_007139167.1 hypothetical protein PHAVU_008G007000g [Phaseolus vulgaris] ESW11161.1 hypothetical protein PHAVU_008G007000g [Phaseolus vulgaris] Length = 69 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 158 VRMMNKNGIMVAHALGHKMTGSCCFHDCPLLVF 60 V++M+KN IM AH LGHKMTG+CCFH CPL V+ Sbjct: 15 VKVMDKNDIMQAHVLGHKMTGNCCFHGCPLPVY 47