BLASTX nr result
ID: Glycyrrhiza29_contig00020843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00020843 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003593499.1 hypothetical protein MTR_2g012840 [Medicago trunc... 50 3e-06 XP_003603923.1 hypothetical protein MTR_3g116630 [Medicago trunc... 50 4e-06 KRX40799.1 hypothetical protein T05_5651 [Trichinella murrelli] 50 5e-06 >XP_003593499.1 hypothetical protein MTR_2g012840 [Medicago truncatula] AES63750.1 hypothetical protein MTR_2g012840 [Medicago truncatula] Length = 52 Score = 50.1 bits (118), Expect = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = -1 Query: 247 FIML*KTVKTLI-KVPPRFELGLLDSESNVLTTRPWD 140 F+ K TL+ +VPPR ELGLLDSESNVLT RPWD Sbjct: 9 FLQPRKYTHTLVFRVPPRLELGLLDSESNVLTARPWD 45 >XP_003603923.1 hypothetical protein MTR_3g116630 [Medicago truncatula] AES74174.1 hypothetical protein MTR_3g116630 [Medicago truncatula] Length = 81 Score = 50.4 bits (119), Expect = 4e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 226 VKTLIKVPPRFELGLLDSESNVLTTRPWD 140 +K KVPPR ELGLLDSESNVLT RPWD Sbjct: 36 MKRTKKVPPRLELGLLDSESNVLTARPWD 64 >KRX40799.1 hypothetical protein T05_5651 [Trichinella murrelli] Length = 62 Score = 49.7 bits (117), Expect = 5e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -1 Query: 229 TVKTLIKVPPRFELGLLDSESNVLTTRPWDQL 134 T++ L KVPPRFELGLLDSES VL PWD L Sbjct: 31 TMEPLSKVPPRFELGLLDSESRVLAVTPWDLL 62