BLASTX nr result
ID: Glycyrrhiza29_contig00020692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00020692 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019426244.1 PREDICTED: fasciclin-like arabinogalactan protein... 61 1e-09 XP_019433293.1 PREDICTED: fasciclin-like arabinogalactan protein... 61 2e-09 XP_003625615.2 fasciclin-like arabinogalactan protein [Medicago ... 59 1e-08 XP_016207929.1 PREDICTED: fasciclin-like arabinogalactan protein... 58 2e-08 XP_015970043.1 PREDICTED: fasciclin-like arabinogalactan protein... 58 2e-08 KYP70864.1 Fasciclin-like arabinogalactan protein 11 [Cajanus ca... 55 9e-08 GAU20278.1 hypothetical protein TSUD_337590 [Trifolium subterran... 55 4e-07 XP_004493964.1 PREDICTED: fasciclin-like arabinogalactan protein... 54 5e-07 KYP70866.1 Fasciclin-like arabinogalactan protein 11 [Cajanus ca... 53 1e-06 >XP_019426244.1 PREDICTED: fasciclin-like arabinogalactan protein 11 [Lupinus angustifolius] OIV92159.1 hypothetical protein TanjilG_18731 [Lupinus angustifolius] Length = 245 Score = 61.2 bits (147), Expect = 1e-09 Identities = 34/52 (65%), Positives = 36/52 (69%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFGXXXXXXXXXXXXXXXPQKNVQASDAPSGS 2 IYSD+QLAVYQVDKVLLPLALF P+KNVQASDAPSGS Sbjct: 160 IYSDSQLAVYQVDKVLLPLALFSAPPTAAPAEAPAPTKPKKNVQASDAPSGS 211 >XP_019433293.1 PREDICTED: fasciclin-like arabinogalactan protein 11 [Lupinus angustifolius] OIW21556.1 hypothetical protein TanjilG_06249 [Lupinus angustifolius] Length = 250 Score = 60.8 bits (146), Expect = 2e-09 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFGXXXXXXXXXXXXXXXPQKNVQASDAPSGS 2 IYSD+QLAVYQVD+VLLPLALFG P+KNV+ASDAPSGS Sbjct: 167 IYSDSQLAVYQVDQVLLPLALFGAPPTAAPAEAPAPTKPEKNVRASDAPSGS 218 >XP_003625615.2 fasciclin-like arabinogalactan protein [Medicago truncatula] AFK36413.1 unknown [Medicago truncatula] AES81833.2 fasciclin-like arabinogalactan protein [Medicago truncatula] Length = 256 Score = 58.5 bits (140), Expect = 1e-08 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFGXXXXXXXXXXXXXXXPQKNVQASDAPSGS 2 IYSDNQLAVYQVD+VLLP+ALFG P+K+V+ASDAP GS Sbjct: 167 IYSDNQLAVYQVDQVLLPMALFGQGPTAAPAEAPAPTKPEKSVRASDAPKGS 218 >XP_016207929.1 PREDICTED: fasciclin-like arabinogalactan protein 11 [Arachis ipaensis] Length = 248 Score = 58.2 bits (139), Expect = 2e-08 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFGXXXXXXXXXXXXXXXPQKNVQ-ASDAPSGS 2 IYSDNQLAVYQVD+VLLPLALFG P+KNV+ ASDAPSGS Sbjct: 159 IYSDNQLAVYQVDQVLLPLALFGAPPTAAPAEAPAPSKPEKNVRAASDAPSGS 211 >XP_015970043.1 PREDICTED: fasciclin-like arabinogalactan protein 11 [Arachis duranensis] Length = 248 Score = 58.2 bits (139), Expect = 2e-08 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFGXXXXXXXXXXXXXXXPQKNVQ-ASDAPSGS 2 IYSDNQLAVYQVD+VLLPLALFG P+KNV+ ASDAPSGS Sbjct: 159 IYSDNQLAVYQVDQVLLPLALFGAPPTAAPAEAPAPSKPEKNVRAASDAPSGS 211 >KYP70864.1 Fasciclin-like arabinogalactan protein 11 [Cajanus cajan] Length = 152 Score = 55.1 bits (131), Expect = 9e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFG-XXXXXXXXXXXXXXXPQKNVQASDAPSGS 2 I+SDNQLAVYQVDKVLLP+ALFG P+KNV+A+D+PSGS Sbjct: 63 IFSDNQLAVYQVDKVLLPMALFGSSAPTAAPAEAPAPTKPEKNVRAADSPSGS 115 >GAU20278.1 hypothetical protein TSUD_337590 [Trifolium subterraneum] Length = 253 Score = 54.7 bits (130), Expect = 4e-07 Identities = 29/52 (55%), Positives = 35/52 (67%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFGXXXXXXXXXXXXXXXPQKNVQASDAPSGS 2 IYSDNQLAVYQVD+VLLP+ALFG P+K+V+A+ AP GS Sbjct: 167 IYSDNQLAVYQVDQVLLPMALFGQAPTAAPAEAPAPTKPEKSVRAAGAPKGS 218 >XP_004493964.1 PREDICTED: fasciclin-like arabinogalactan protein 11 [Cicer arietinum] Length = 253 Score = 54.3 bits (129), Expect = 5e-07 Identities = 30/53 (56%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFG-XXXXXXXXXXXXXXXPQKNVQASDAPSGS 2 IYSDNQLAVYQVDKVLLP+ALFG +K V++SDAP+GS Sbjct: 167 IYSDNQLAVYQVDKVLLPMALFGSVAPTAAPTEAPAPSKSEKRVRSSDAPAGS 219 >KYP70866.1 Fasciclin-like arabinogalactan protein 11 [Cajanus cajan] Length = 247 Score = 53.1 bits (126), Expect = 1e-06 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -3 Query: 157 IYSDNQLAVYQVDKVLLPLALFG-XXXXXXXXXXXXXXXPQKNVQASDAPSGS 2 I+SDNQLAVYQVDKVLLP+A+FG P+KNV+A+D+P+GS Sbjct: 161 IFSDNQLAVYQVDKVLLPMAIFGSSAPASAPAEAPAPTKPEKNVRAADSPTGS 213