BLASTX nr result
ID: Glycyrrhiza29_contig00020463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00020463 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019444141.1 PREDICTED: serine/threonine-protein phosphatase P... 74 2e-13 XP_019444142.1 PREDICTED: serine/threonine-protein phosphatase P... 74 2e-13 XP_015969269.1 PREDICTED: serine/threonine-protein phosphatase P... 73 5e-13 XP_019425414.1 PREDICTED: serine/threonine-protein phosphatase P... 71 2e-12 XP_004494304.1 PREDICTED: serine/threonine-protein phosphatase P... 71 2e-12 XP_019425413.1 PREDICTED: serine/threonine-protein phosphatase P... 71 2e-12 XP_019455478.1 PREDICTED: serine/threonine-protein phosphatase P... 70 4e-12 XP_010524038.1 PREDICTED: serine/threonine-protein phosphatase P... 69 1e-11 KYP71645.1 Serine/threonine-protein phosphatase PP2A catalytic s... 69 2e-11 XP_006402781.1 hypothetical protein EUTSA_v10006109mg [Eutrema s... 69 2e-11 NP_001189732.1 protein phosphatase 2A-3 [Arabidopsis thaliana] A... 66 3e-11 XP_018482781.1 PREDICTED: serine/threonine-protein phosphatase P... 68 3e-11 XP_010550105.1 PREDICTED: serine/threonine-protein phosphatase P... 68 3e-11 KFK35108.1 hypothetical protein AALP_AA5G237100 [Arabis alpina] 68 3e-11 NP_001324022.1 protein phosphatase 2A-3 [Arabidopsis thaliana] A... 66 3e-11 XP_018478095.1 PREDICTED: serine/threonine-protein phosphatase P... 67 3e-11 NP_001324021.1 protein phosphatase 2A-3 [Arabidopsis thaliana] A... 66 4e-11 XP_013591939.1 PREDICTED: serine/threonine-protein phosphatase P... 65 4e-11 XP_018478094.1 PREDICTED: serine/threonine-protein phosphatase P... 67 4e-11 BAA92699.1 type 2A protein phosphatase-3 [Vicia faba] 67 4e-11 >XP_019444141.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X1 [Lupinus angustifolius] Length = 313 Score = 73.6 bits (179), Expect = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANSLPSES+HDLDEQISQLMQCKPLSEQQVK LCE Sbjct: 1 MGANSLPSESSHDLDEQISQLMQCKPLSEQQVKVLCE 37 >XP_019444142.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Lupinus angustifolius] Length = 313 Score = 73.6 bits (179), Expect = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANSLPSES+HDLDEQISQLMQCKPLSEQQVK LCE Sbjct: 1 MGANSLPSESSHDLDEQISQLMQCKPLSEQQVKVLCE 37 >XP_015969269.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Arachis duranensis] XP_016162934.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Arachis ipaensis] Length = 313 Score = 72.8 bits (177), Expect = 5e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANSLPS+STHDLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSLPSDSTHDLDEQISQLMQCKPLSEQQVRVLCE 37 >XP_019425414.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like isoform X2 [Lupinus angustifolius] OIV92256.1 hypothetical protein TanjilG_00274 [Lupinus angustifolius] Length = 313 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+PSE +HDLDEQISQLMQCKPLSEQQVK LCE Sbjct: 1 MGANSIPSEGSHDLDEQISQLMQCKPLSEQQVKVLCE 37 >XP_004494304.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Cicer arietinum] Length = 313 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+ +ESTHDLDEQISQLMQCKPLSEQQVK+LCE Sbjct: 1 MGANSMLTESTHDLDEQISQLMQCKPLSEQQVKELCE 37 >XP_019425413.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like isoform X1 [Lupinus angustifolius] Length = 323 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+PSE +HDLDEQISQLMQCKPLSEQQVK LCE Sbjct: 1 MGANSIPSEGSHDLDEQISQLMQCKPLSEQQVKVLCE 37 >XP_019455478.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Lupinus angustifolius] OIW05193.1 hypothetical protein TanjilG_19824 [Lupinus angustifolius] Length = 313 Score = 70.1 bits (170), Expect = 4e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 M ANSLPS+S+HDLDEQISQLMQCKPLSEQQVK LCE Sbjct: 1 MSANSLPSDSSHDLDEQISQLMQCKPLSEQQVKVLCE 37 >XP_010524038.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit [Tarenaya hassleriana] Length = 313 Score = 68.9 bits (167), Expect = 1e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANSLP+EST DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSLPTESTLDLDEQISQLMQCKPLSEQQVRALCE 37 >KYP71645.1 Serine/threonine-protein phosphatase PP2A catalytic subunit [Cajanus cajan] Length = 313 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+ SES+HDLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSMLSESSHDLDEQISQLMQCKPLSEQQVRGLCE 37 >XP_006402781.1 hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum] ESQ44234.1 hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum] Length = 313 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANSLP++ST DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSLPTDSTLDLDEQISQLMQCKPLSEQQVRSLCE 37 >NP_001189732.1 protein phosphatase 2A-3 [Arabidopsis thaliana] AEC10129.1 protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 171 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCE 37 >XP_018482781.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit-like [Raphanus sativus] XP_018483637.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit-like [Raphanus sativus] Length = 313 Score = 67.8 bits (164), Expect = 3e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+P+E+T DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSIPTEATIDLDEQISQLMQCKPLSEQQVRSLCE 37 >XP_010550105.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit isoform X1 [Tarenaya hassleriana] Length = 313 Score = 67.8 bits (164), Expect = 3e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANSLP++ST DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSLPTDSTLDLDEQISQLMQCKPLSEQQVRALCE 37 >KFK35108.1 hypothetical protein AALP_AA5G237100 [Arabis alpina] Length = 313 Score = 67.8 bits (164), Expect = 3e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANSLP++ST DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSLPTDSTLDLDEQISQLMQCKPLSEQQVRALCE 37 >NP_001324022.1 protein phosphatase 2A-3 [Arabidopsis thaliana] ANM61825.1 protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 178 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCE 37 >XP_018478095.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Raphanus sativus] Length = 285 Score = 67.4 bits (163), Expect = 3e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+P+++T DLDEQISQLMQCKPLSEQQVK LCE Sbjct: 1 MGANSVPTDATIDLDEQISQLMQCKPLSEQQVKSLCE 37 >NP_001324021.1 protein phosphatase 2A-3 [Arabidopsis thaliana] ANM61824.1 protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 180 Score = 65.9 bits (159), Expect = 4e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCE 37 >XP_013591939.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Brassica oleracea var. oleracea] Length = 166 Score = 65.5 bits (158), Expect = 4e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCE Sbjct: 1 MGANSVPADATLDLDEQISQLMQCKPLSEQQVRALCE 37 >XP_018478094.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X1 [Raphanus sativus] Length = 313 Score = 67.4 bits (163), Expect = 4e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS+P+++T DLDEQISQLMQCKPLSEQQVK LCE Sbjct: 1 MGANSVPTDATIDLDEQISQLMQCKPLSEQQVKSLCE 37 >BAA92699.1 type 2A protein phosphatase-3 [Vicia faba] Length = 313 Score = 67.4 bits (163), Expect = 4e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 113 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCE 3 MGANS +ESTHDL+EQISQLMQCKPLSEQQVK+LCE Sbjct: 1 MGANSNLAESTHDLNEQISQLMQCKPLSEQQVKELCE 37