BLASTX nr result
ID: Glycyrrhiza29_contig00020241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00020241 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012571293.1 PREDICTED: putative pentatricopeptide repeat-cont... 110 8e-27 XP_013459888.1 pentatricopeptide (PPR) repeat protein [Medicago ... 97 1e-21 XP_014629134.1 PREDICTED: putative pentatricopeptide repeat-cont... 90 4e-19 KRH75048.1 hypothetical protein GLYMA_01G059000 [Glycine max] 90 4e-19 XP_019464912.1 PREDICTED: putative pentatricopeptide repeat-cont... 86 8e-18 XP_015966122.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 2e-17 XP_006573154.1 PREDICTED: putative pentatricopeptide repeat-cont... 84 3e-17 XP_016200436.1 PREDICTED: putative pentatricopeptide repeat-cont... 84 4e-17 XP_014629135.1 PREDICTED: putative pentatricopeptide repeat-cont... 84 5e-17 KYP31404.1 hypothetical protein KK1_048306 [Cajanus cajan] 82 3e-16 KRH09256.1 hypothetical protein GLYMA_16G206600 [Glycine max] 81 3e-16 XP_015965999.1 PREDICTED: putative pentatricopeptide repeat-cont... 81 3e-16 XP_016204033.1 PREDICTED: putative pentatricopeptide repeat-cont... 80 6e-16 KYP50144.1 Pentatricopeptide repeat-containing protein At1g62910... 80 9e-16 XP_016203976.1 PREDICTED: putative pentatricopeptide repeat-cont... 80 9e-16 XP_003533262.1 PREDICTED: putative pentatricopeptide repeat-cont... 79 2e-15 XP_016204039.1 PREDICTED: putative pentatricopeptide repeat-cont... 77 8e-15 XP_015966106.1 PREDICTED: putative pentatricopeptide repeat-cont... 77 8e-15 XP_016204038.1 PREDICTED: putative pentatricopeptide repeat-cont... 77 8e-15 XP_016204025.1 PREDICTED: putative pentatricopeptide repeat-cont... 77 8e-15 >XP_012571293.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Cicer arietinum] Length = 508 Score = 110 bits (276), Expect = 8e-27 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 1/81 (1%) Frame = -1 Query: 242 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 63 SS+ +N+NAV N+P +RT LLNSI++L DV+ AVT FH+M M PFP VKDFNFLFTF+ Sbjct: 25 SSSTTNSNAVNNNPINRTHLLNSIKTLPDVNAAVTFFHQMLTMNPFPNVKDFNFLFTFIT 84 Query: 62 -KTKRYTRAISLIKHAHSLGV 3 KTK YT AISLIKHAHSLGV Sbjct: 85 KKTKHYTTAISLIKHAHSLGV 105 >XP_013459888.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH33919.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 587 Score = 97.1 bits (240), Expect = 1e-21 Identities = 46/81 (56%), Positives = 62/81 (76%), Gaps = 1/81 (1%) Frame = -1 Query: 242 SSTHSNNNAVINDP-RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFV 66 S+ H ++NAV ++P +RT LLN+IR+L++V+ AVT FH+M +KP P +KDFN LFTF+ Sbjct: 23 SNLHFSSNAVNSNPTNTRTHLLNTIRTLTNVNTAVTFFHQMLTLKPLPNIKDFNLLFTFI 82 Query: 65 AKTKRYTRAISLIKHAHSLGV 3 KTK YT ISLIKHAHS + Sbjct: 83 TKTKNYTTTISLIKHAHSFNI 103 >XP_014629134.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] Length = 583 Score = 89.7 bits (221), Expect = 4e-19 Identities = 45/80 (56%), Positives = 56/80 (70%) Frame = -1 Query: 242 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 63 S H++NNA IN R+ Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 45 SDNHNHNNASINTRRA--QFLDSMRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 102 Query: 62 KTKRYTRAISLIKHAHSLGV 3 K K YT AISLIKH +GV Sbjct: 103 KMKHYTTAISLIKHMSYIGV 122 >KRH75048.1 hypothetical protein GLYMA_01G059000 [Glycine max] Length = 608 Score = 89.7 bits (221), Expect = 4e-19 Identities = 45/80 (56%), Positives = 56/80 (70%) Frame = -1 Query: 242 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 63 S H++NNA IN R+ Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 45 SDNHNHNNASINTRRA--QFLDSMRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 102 Query: 62 KTKRYTRAISLIKHAHSLGV 3 K K YT AISLIKH +GV Sbjct: 103 KMKHYTTAISLIKHMSYIGV 122 >XP_019464912.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Lupinus angustifolius] Length = 609 Score = 85.9 bits (211), Expect = 8e-18 Identities = 44/80 (55%), Positives = 54/80 (67%) Frame = -1 Query: 242 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 63 SS +++ +IN RT LLNSIR+L +VD A FHEM ++ P P VKDFN LF F+ Sbjct: 47 SSIEIHHDTIIN----RTHLLNSIRNLKNVDTAFNFFHEMVSINPLPSVKDFNLLFGFIV 102 Query: 62 KTKRYTRAISLIKHAHSLGV 3 K K YT ISLIKH +SLGV Sbjct: 103 KMKHYTTTISLIKHLYSLGV 122 >XP_015966122.1 PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like, partial [Arachis duranensis] Length = 1180 Score = 84.7 bits (208), Expect = 2e-17 Identities = 46/80 (57%), Positives = 55/80 (68%) Frame = -1 Query: 242 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 63 SSTH I+ + RT L+NSIR+L ++D A+ LF +M +M P PCVKDFN LF VA Sbjct: 7 SSTH------IHAIKDRTYLINSIRNLQNLDPALHLFQQMLSMNPLPCVKDFNLLFGSVA 60 Query: 62 KTKRYTRAISLIKHAHSLGV 3 K K YT AISLIKH SLGV Sbjct: 61 KMKHYTVAISLIKHVFSLGV 80 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/64 (53%), Positives = 46/64 (71%) Frame = -1 Query: 200 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 21 + R L++SIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K K YT AISLIK+ Sbjct: 630 KDRPLLVDSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAISLIKY 689 Query: 20 AHSL 9 SL Sbjct: 690 LFSL 693 >XP_006573154.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_003517841.2 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_014629146.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH75063.1 hypothetical protein GLYMA_01G059900 [Glycine max] Length = 604 Score = 84.3 bits (207), Expect = 3e-17 Identities = 42/80 (52%), Positives = 53/80 (66%) Frame = -1 Query: 242 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 63 S + S + V + SR Q L+S+R+ VD A+ +H+M MKPFPCVKDFN LF+ VA Sbjct: 39 SHSSSTFSFVSDSDTSRAQFLDSMRNAKSVDVALDFYHKMVTMKPFPCVKDFNLLFSIVA 98 Query: 62 KTKRYTRAISLIKHAHSLGV 3 K K YT AISLIKH +GV Sbjct: 99 KMKHYTTAISLIKHMSYIGV 118 >XP_016200436.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 600 Score = 84.0 bits (206), Expect = 4e-17 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 7/83 (8%) Frame = -1 Query: 230 SNNNAVINDPR-------SRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFT 72 S++N +D R +RTQLLNSIR+L +VD A LFH+M +M P P KDFN LF Sbjct: 34 SSSNYCTHDSRIGVHKTVNRTQLLNSIRNLKNVDSAFNLFHKMVSMNPLPSEKDFNLLFG 93 Query: 71 FVAKTKRYTRAISLIKHAHSLGV 3 F+ + K YT AISLIKH SLGV Sbjct: 94 FIVRMKDYTTAISLIKHMCSLGV 116 >XP_014629135.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_014629136.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH75044.1 hypothetical protein GLYMA_01G058700 [Glycine max] KRH75045.1 hypothetical protein GLYMA_01G058700 [Glycine max] Length = 597 Score = 83.6 bits (205), Expect = 5e-17 Identities = 44/80 (55%), Positives = 54/80 (67%) Frame = -1 Query: 242 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 63 SS+ + A IN SR Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 34 SSSTFSTYASINT--SRAQFLDSLRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 91 Query: 62 KTKRYTRAISLIKHAHSLGV 3 K K YT AISLIKH +GV Sbjct: 92 KMKHYTTAISLIKHMSYIGV 111 >KYP31404.1 hypothetical protein KK1_048306 [Cajanus cajan] Length = 586 Score = 81.6 bits (200), Expect = 3e-16 Identities = 41/79 (51%), Positives = 53/79 (67%) Frame = -1 Query: 239 STHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAK 60 S+ + + V RT+LL SIR++ +VD A+ LFH+M AMKPFP KDFN L + +AK Sbjct: 26 SSSTFSTLVSGSDTRRTKLLGSIRNIRNVDTALDLFHQMIAMKPFPSNKDFNLLLSIIAK 85 Query: 59 TKRYTRAISLIKHAHSLGV 3 K YT ISL KH +SLGV Sbjct: 86 MKHYTTVISLTKHMYSLGV 104 >KRH09256.1 hypothetical protein GLYMA_16G206600 [Glycine max] Length = 559 Score = 81.3 bits (199), Expect = 3e-16 Identities = 43/85 (50%), Positives = 57/85 (67%), Gaps = 6/85 (7%) Frame = -1 Query: 242 SSTH--SNNNAVINDPRSRTQLLNSIRSLSDVDGAVTL----FHEMAAMKPFPCVKDFNF 81 S+TH S + I+D +RT+LLNSIR+L D AV++ FH M + PFPC++DFN Sbjct: 22 SNTHPFSTSPPSISDAAARTRLLNSIRTLQSADAAVSVSVDFFHRMLTLNPFPCIQDFNL 81 Query: 80 LFTFVAKTKRYTRAISLIKHAHSLG 6 LF VAK++ + AISLIK HSLG Sbjct: 82 LFGIVAKSQHFATAISLIKTLHSLG 106 >XP_015965999.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] Length = 600 Score = 81.3 bits (199), Expect = 3e-16 Identities = 44/88 (50%), Positives = 56/88 (63%), Gaps = 7/88 (7%) Frame = -1 Query: 245 FSSTHSNNNAVINDPR-------SRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDF 87 ++ S++N +D R +RTQLLNSIR+L +VD A LF +M +M P P KDF Sbjct: 29 YNLAFSSSNYCTHDSRIGVHKTVNRTQLLNSIRNLKNVDSAFNLFRKMVSMNPLPSEKDF 88 Query: 86 NFLFTFVAKTKRYTRAISLIKHAHSLGV 3 N LF F+ + K YT AISLIKH SLGV Sbjct: 89 NLLFGFIVRMKDYTTAISLIKHMCSLGV 116 >XP_016204033.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Arachis ipaensis] Length = 600 Score = 80.5 bits (197), Expect = 6e-16 Identities = 38/70 (54%), Positives = 50/70 (71%) Frame = -1 Query: 212 INDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAIS 33 I+ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K K YT AIS Sbjct: 43 IDTIKDRPHLVNSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAIS 102 Query: 32 LIKHAHSLGV 3 LIKH SLG+ Sbjct: 103 LIKHLFSLGL 112 >KYP50144.1 Pentatricopeptide repeat-containing protein At1g62910 family [Cajanus cajan] Length = 519 Score = 80.1 bits (196), Expect = 9e-16 Identities = 39/64 (60%), Positives = 48/64 (75%) Frame = -1 Query: 194 RTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKHAH 15 RT+LL SIR++ +VD A+ LFH+M AMKPFP KDFN L + +AK K YT ISL KH + Sbjct: 62 RTKLLVSIRNIRNVDTALDLFHQMIAMKPFPSNKDFNLLLSIIAKMKHYTTVISLTKHMY 121 Query: 14 SLGV 3 SLGV Sbjct: 122 SLGV 125 >XP_016203976.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 597 Score = 80.1 bits (196), Expect = 9e-16 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = -1 Query: 200 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 21 + RT L+NSIR+L ++D A+ LF +M +M P PCVKDFN LF + K K YT AISLIKH Sbjct: 44 KDRTYLINSIRNLQNLDPALHLFQQMLSMNPLPCVKDFNLLFGSIVKMKHYTVAISLIKH 103 Query: 20 AHSLGV 3 SLG+ Sbjct: 104 VFSLGL 109 >XP_003533262.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH38755.1 hypothetical protein GLYMA_09G156000 [Glycine max] Length = 594 Score = 79.0 bits (193), Expect = 2e-15 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 2/82 (2%) Frame = -1 Query: 245 FSSTHSNNNAVINDPRSRTQLLNSIRSLSDVDG--AVTLFHEMAAMKPFPCVKDFNFLFT 72 +S S + I+D RT LLNSIR+L D AV FH M + PFPC++DFN LF Sbjct: 23 YSHPFSTSPPPISDAAHRTLLLNSIRTLETADAVVAVDFFHRMLTLTPFPCIQDFNLLFG 82 Query: 71 FVAKTKRYTRAISLIKHAHSLG 6 VAK++ Y AISLIK HSLG Sbjct: 83 LVAKSQHYATAISLIKILHSLG 104 >XP_016204039.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 587 Score = 77.4 bits (189), Expect = 8e-15 Identities = 38/76 (50%), Positives = 51/76 (67%) Frame = -1 Query: 236 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 57 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K Sbjct: 22 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMLSMNPLPCVNDFNFLFSSIVKM 81 Query: 56 KRYTRAISLIKHAHSL 9 K YT AISLIKH SL Sbjct: 82 KHYTAAISLIKHLFSL 97 >XP_015966106.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] Length = 587 Score = 77.4 bits (189), Expect = 8e-15 Identities = 38/78 (48%), Positives = 52/78 (66%) Frame = -1 Query: 236 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 57 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFL + + K Sbjct: 22 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLCSSIVKM 81 Query: 56 KRYTRAISLIKHAHSLGV 3 K YT AISLIKH SLG+ Sbjct: 82 KHYTSAISLIKHLFSLGL 99 >XP_016204038.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 589 Score = 77.4 bits (189), Expect = 8e-15 Identities = 38/76 (50%), Positives = 51/76 (67%) Frame = -1 Query: 236 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 57 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K Sbjct: 24 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMLSMNPLPCVNDFNFLFSSIVKM 83 Query: 56 KRYTRAISLIKHAHSL 9 K YT AISLIKH SL Sbjct: 84 KHYTAAISLIKHLFSL 99 >XP_016204025.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 598 Score = 77.4 bits (189), Expect = 8e-15 Identities = 36/66 (54%), Positives = 49/66 (74%) Frame = -1 Query: 200 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 21 + RT+L++SIR+L ++D A+ LFH+M +M P P VKDF LF+ + K K YT AISLIKH Sbjct: 45 KDRTRLIDSIRNLQNLDSALHLFHKMVSMNPLPSVKDFTLLFSSMVKMKHYTAAISLIKH 104 Query: 20 AHSLGV 3 SLG+ Sbjct: 105 LFSLGL 110