BLASTX nr result
ID: Glycyrrhiza29_contig00020172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00020172 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003598106.2 F-box protein interaction domain protein [Medicag... 76 2e-14 GAU20084.1 hypothetical protein TSUD_381760 [Trifolium subterran... 75 5e-14 GAU20081.1 hypothetical protein TSUD_381730 [Trifolium subterran... 74 6e-14 XP_003601620.1 F-box protein interaction domain protein [Medicag... 73 2e-13 XP_013453971.1 F-box protein interaction domain protein [Medicag... 72 2e-13 GAU20082.1 hypothetical protein TSUD_381740 [Trifolium subterran... 73 2e-13 XP_003614694.1 F-box protein interaction domain protein [Medicag... 72 5e-13 XP_003614689.2 F-box protein interaction domain protein [Medicag... 72 5e-13 XP_003614663.2 F-box protein interaction domain protein [Medicag... 72 5e-13 XP_003614662.1 F-box protein interaction domain protein [Medicag... 72 5e-13 XP_003614687.1 F-box protein interaction domain protein [Medicag... 72 6e-13 XP_003599631.2 F-box protein interaction domain protein [Medicag... 71 8e-13 XP_013459319.1 F-box protein interaction domain protein [Medicag... 71 9e-13 XP_003598334.1 F-box protein interaction domain protein [Medicag... 71 9e-13 XP_013464670.1 F-box protein interaction domain protein [Medicag... 71 1e-12 XP_003599211.1 F-box protein interaction domain protein [Medicag... 71 1e-12 AFK34264.1 unknown [Medicago truncatula] 71 1e-12 XP_013459073.1 F-box protein interaction domain protein [Medicag... 71 1e-12 XP_003623247.1 F-box protein interaction domain protein [Medicag... 70 2e-12 GAU20083.1 hypothetical protein TSUD_381750 [Trifolium subterran... 70 2e-12 >XP_003598106.2 F-box protein interaction domain protein [Medicago truncatula] AES68357.2 F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 75.9 bits (185), Expect = 2e-14 Identities = 40/60 (66%), Positives = 47/60 (78%) Frame = +1 Query: 52 NPITTFTSR*FALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +PI T TS +L A+ LPTLPFE++ EIL RLPVK L + RC CKS+NSLISDPKFAKK Sbjct: 29 SPIGTLTSSP-SLYALPLPTLPFELIEEILSRLPVKLLLQLRCSCKSWNSLISDPKFAKK 87 >GAU20084.1 hypothetical protein TSUD_381760 [Trifolium subterraneum] Length = 421 Score = 74.7 bits (182), Expect = 5e-14 Identities = 35/60 (58%), Positives = 47/60 (78%) Frame = +1 Query: 52 NPITTFTSR*FALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +P ++++ L+ LPTLPFE++ EIL +LPVKSL +F+CVCKS+ SLISDPKFAKK Sbjct: 40 SPSSSYSIVTLTLQPPLLPTLPFELIAEILSKLPVKSLMQFQCVCKSWKSLISDPKFAKK 99 >GAU20081.1 hypothetical protein TSUD_381730 [Trifolium subterraneum] Length = 300 Score = 73.9 bits (180), Expect = 6e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +1 Query: 103 LPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 LPTLPFE+++EIL RLP+KSL +F+CVCKS+ SLISDPKFAKK Sbjct: 65 LPTLPFELIVEILSRLPMKSLMQFQCVCKSWKSLISDPKFAKK 107 >XP_003601620.1 F-box protein interaction domain protein [Medicago truncatula] AES71871.1 F-box protein interaction domain protein [Medicago truncatula] Length = 405 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +1 Query: 94 AVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 A LPTLPFE++ EIL RLPVK L + RC+CKSFNSLISDPKFAKK Sbjct: 49 APPLPTLPFELVAEILCRLPVKLLLQLRCLCKSFNSLISDPKFAKK 94 >XP_013453971.1 F-box protein interaction domain protein [Medicago truncatula] KEH28002.1 F-box protein interaction domain protein [Medicago truncatula] Length = 269 Score = 72.0 bits (175), Expect = 2e-13 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 85 ALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +L + LPT+PF+++ EIL RLPVK L +FRCVCK +NSLISDPKFAKK Sbjct: 37 SLHSSPLPTIPFDLIPEILHRLPVKPLMQFRCVCKWWNSLISDPKFAKK 85 >GAU20082.1 hypothetical protein TSUD_381740 [Trifolium subterraneum] Length = 391 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +1 Query: 103 LPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 LPTLPFE+++EIL +LP+KSL +F+CVCKS+ SLISDPKFAKK Sbjct: 42 LPTLPFELIVEILSKLPMKSLMQFQCVCKSWKSLISDPKFAKK 84 >XP_003614694.1 F-box protein interaction domain protein [Medicago truncatula] AES97652.1 F-box protein interaction domain protein [Medicago truncatula] Length = 396 Score = 72.0 bits (175), Expect = 5e-13 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 85 ALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +L + LPT+PF+++ EIL RLPVK L +FRCVCK +NSLISDPKFAKK Sbjct: 37 SLHSSPLPTIPFDLIPEILHRLPVKPLMQFRCVCKWWNSLISDPKFAKK 85 >XP_003614689.2 F-box protein interaction domain protein [Medicago truncatula] AES97647.2 F-box protein interaction domain protein [Medicago truncatula] Length = 397 Score = 72.0 bits (175), Expect = 5e-13 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 85 ALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +L + LPT+PF+++ EIL RLPVK L +FRCVCK +NSLISDPKFAKK Sbjct: 37 SLHSSPLPTIPFDLIPEILHRLPVKPLMQFRCVCKWWNSLISDPKFAKK 85 >XP_003614663.2 F-box protein interaction domain protein [Medicago truncatula] AES97621.2 F-box protein interaction domain protein [Medicago truncatula] Length = 1041 Score = 72.0 bits (175), Expect = 5e-13 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 85 ALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +L + LPT+PF+++ EIL RLPVK L +FRCVCK +NSLISDPKFAKK Sbjct: 37 SLHSSPLPTIPFDLIPEILHRLPVKPLMQFRCVCKWWNSLISDPKFAKK 85 >XP_003614662.1 F-box protein interaction domain protein [Medicago truncatula] AES97620.1 F-box protein interaction domain protein [Medicago truncatula] Length = 347 Score = 71.6 bits (174), Expect = 5e-13 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 85 ALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +L + LPT+PF+++ EIL RLPVK L +FRCVCK +NSLISDPKFAKK Sbjct: 37 SLHSSPLPTIPFDLIPEILYRLPVKPLMQFRCVCKWWNSLISDPKFAKK 85 >XP_003614687.1 F-box protein interaction domain protein [Medicago truncatula] AES97645.1 F-box protein interaction domain protein [Medicago truncatula] Length = 386 Score = 71.6 bits (174), Expect = 6e-13 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 85 ALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +L + LPT+PF+++ EIL RLPVK L +FRCVCK +NSLISDPKFAKK Sbjct: 37 SLHSSPLPTIPFDLIPEILYRLPVKPLMQFRCVCKWWNSLISDPKFAKK 85 >XP_003599631.2 F-box protein interaction domain protein [Medicago truncatula] AES69882.2 F-box protein interaction domain protein [Medicago truncatula] Length = 345 Score = 71.2 bits (173), Expect = 8e-13 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +1 Query: 100 ALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +LP+LPF+++ EIL RLPVKSL +FRCVCKS+ SLISDPKFAKK Sbjct: 16 SLPSLPFDLVPEILCRLPVKSLLQFRCVCKSWKSLISDPKFAKK 59 >XP_013459319.1 F-box protein interaction domain protein [Medicago truncatula] KEH33350.1 F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 71.2 bits (173), Expect = 9e-13 Identities = 40/66 (60%), Positives = 46/66 (69%), Gaps = 6/66 (9%) Frame = +1 Query: 52 NPITTFTSR*FAL------RAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISD 213 NP+ T TS +L A LPTLPF+++ EIL LPVK L R RCVCKS+NSLISD Sbjct: 6 NPLPTLTSPPPSLSFGNSIHAPPLPTLPFDVIPEILCFLPVKFLLRSRCVCKSWNSLISD 65 Query: 214 PKFAKK 231 PKFAKK Sbjct: 66 PKFAKK 71 >XP_003598334.1 F-box protein interaction domain protein [Medicago truncatula] AES68585.1 F-box protein interaction domain protein [Medicago truncatula] Length = 417 Score = 71.2 bits (173), Expect = 9e-13 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 103 LPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 LPTLPF+++ EIL RLPVK L + RC+CKSFNSLISDPKFAKK Sbjct: 33 LPTLPFDLVAEILCRLPVKLLVQLRCLCKSFNSLISDPKFAKK 75 >XP_013464670.1 F-box protein interaction domain protein [Medicago truncatula] KEH38705.1 F-box protein interaction domain protein [Medicago truncatula] Length = 358 Score = 70.9 bits (172), Expect = 1e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +1 Query: 94 AVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 A+ LPTLPF+++ EIL RLPVK L + RC+CKS NSLISDPKFAKK Sbjct: 27 ALPLPTLPFDLVAEILCRLPVKLLIQLRCLCKSINSLISDPKFAKK 72 >XP_003599211.1 F-box protein interaction domain protein [Medicago truncatula] AES69462.1 F-box protein interaction domain protein [Medicago truncatula] Length = 380 Score = 70.9 bits (172), Expect = 1e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +1 Query: 97 VALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 + LPTLPF++L EIL RLP+K L + RC+CKSFNSLISDPKFAKK Sbjct: 32 IQLPTLPFDVLPEILCRLPMKLLGQLRCLCKSFNSLISDPKFAKK 76 >AFK34264.1 unknown [Medicago truncatula] Length = 405 Score = 70.9 bits (172), Expect = 1e-12 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 94 AVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 A LPTLP E++ EIL RLPVK L + RC+CKSFNSLISDPKFAKK Sbjct: 49 APPLPTLPLELVAEILCRLPVKLLLQLRCLCKSFNSLISDPKFAKK 94 >XP_013459073.1 F-box protein interaction domain protein [Medicago truncatula] KEH33126.1 F-box protein interaction domain protein [Medicago truncatula] Length = 450 Score = 70.9 bits (172), Expect = 1e-12 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 85 ALRAVALPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 +L+A LPTLPF+++ EIL R+PVK L + RC+CK FNSLISDPKFA+K Sbjct: 92 SLQAAPLPTLPFDLVAEILCRIPVKLLIQLRCLCKCFNSLISDPKFAEK 140 >XP_003623247.1 F-box protein interaction domain protein [Medicago truncatula] AES79465.1 F-box protein interaction domain protein [Medicago truncatula] Length = 396 Score = 70.5 bits (171), Expect = 2e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 103 LPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 LPTLPF+++LEIL RLPVKSL +F+CVCKS+ S IS PKFAKK Sbjct: 46 LPTLPFDLVLEILYRLPVKSLMQFKCVCKSWKSFISHPKFAKK 88 >GAU20083.1 hypothetical protein TSUD_381750 [Trifolium subterraneum] Length = 410 Score = 70.5 bits (171), Expect = 2e-12 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +1 Query: 103 LPTLPFEILLEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKK 231 LPTLPF++++EIL +LPVKSL +F+CVCKS+ SLISDP FAKK Sbjct: 65 LPTLPFDLIVEILYKLPVKSLMQFQCVCKSWKSLISDPNFAKK 107