BLASTX nr result
ID: Glycyrrhiza29_contig00019997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00019997 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU39698.1 hypothetical protein TSUD_321130 [Trifolium subterran... 76 1e-16 XP_003598504.1 LRR and NB-ARC domain disease resistance protein ... 79 3e-15 GAU39699.1 hypothetical protein TSUD_321120 [Trifolium subterran... 76 4e-15 GAU28266.1 hypothetical protein TSUD_118730 [Trifolium subterran... 76 3e-14 XP_003598506.2 CC-NBS-LRR resistance protein, putative [Medicago... 72 3e-14 XP_013466886.1 LRR and NB-ARC domain disease resistance protein ... 75 5e-14 XP_003598494.2 LRR and NB-ARC domain disease resistance protein ... 74 9e-14 XP_003598501.1 LRR and NB-ARC domain disease resistance protein ... 73 2e-13 XP_003598093.2 NB-ARC domain disease resistance protein [Medicag... 73 3e-13 XP_003598492.1 LRR and NB-ARC domain disease resistance protein ... 73 3e-13 XP_003598489.1 LRR and NB-ARC domain disease resistance protein ... 73 3e-13 XP_004498673.1 PREDICTED: putative disease resistance RPP13-like... 72 8e-13 XP_013442215.1 NB-ARC domain disease resistance protein, putativ... 70 2e-12 XP_003613519.1 LRR and NB-ARC domain disease resistance protein ... 66 9e-11 XP_003598466.1 LRR and NB-ARC domain disease resistance protein ... 65 2e-10 XP_003598503.1 NB-ARC domain disease resistance protein, putativ... 63 2e-10 XP_013466896.1 NB-ARC domain disease resistance protein [Medicag... 64 3e-10 XP_007218892.1 hypothetical protein PRUPE_ppa000391mg [Prunus pe... 64 4e-10 ONI21036.1 hypothetical protein PRUPE_2G046900 [Prunus persica] 64 4e-10 XP_008245919.1 PREDICTED: putative disease resistance RPP13-like... 64 5e-10 >GAU39698.1 hypothetical protein TSUD_321130 [Trifolium subterraneum] Length = 82 Score = 76.3 bits (186), Expect = 1e-16 Identities = 38/53 (71%), Positives = 46/53 (86%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MAT++ +A+L+AS+E L+ KIVSGEFVD FRSTKLD +LLEKM TLLSLQAV Sbjct: 1 MATVVGQALLAASLEALVGKIVSGEFVDLFRSTKLDAALLEKMNITLLSLQAV 53 >XP_003598504.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68755.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1319 Score = 78.6 bits (192), Expect = 3e-15 Identities = 39/53 (73%), Positives = 49/53 (92%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MATI+ EA+L+AS+E+L+EKIVSGEFVD FRSTKLD +LLEK++ T+LSLQAV Sbjct: 1 MATIVGEALLAASLEVLMEKIVSGEFVDLFRSTKLDVALLEKLKITMLSLQAV 53 >GAU39699.1 hypothetical protein TSUD_321120 [Trifolium subterraneum] Length = 230 Score = 76.3 bits (186), Expect = 4e-15 Identities = 38/53 (71%), Positives = 46/53 (86%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MAT++ +A+L+AS+E L+ KIVSGEFVD FRSTKLD +LLEKM TLLSLQAV Sbjct: 1 MATVVGQALLAASLEALVGKIVSGEFVDLFRSTKLDAALLEKMNITLLSLQAV 53 >GAU28266.1 hypothetical protein TSUD_118730 [Trifolium subterraneum] Length = 1345 Score = 75.9 bits (185), Expect = 3e-14 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MATI+ EA+L+AS+E+L+EKIVSGEF + FRSTKLD LLEK++ TLLSLQAV Sbjct: 1 MATIVGEALLAASLEVLLEKIVSGEFAELFRSTKLDAVLLEKLKITLLSLQAV 53 >XP_003598506.2 CC-NBS-LRR resistance protein, putative [Medicago truncatula] AES68757.2 CC-NBS-LRR resistance protein, putative [Medicago truncatula] Length = 159 Score = 72.4 bits (176), Expect = 3e-14 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = +2 Query: 92 IIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 ++ EA+L+AS E+L+EKIVSG+FVDFFRSTKLD SLL+K + TLLSLQAV Sbjct: 1 MVVEALLAASFEVLLEKIVSGDFVDFFRSTKLDLSLLKKQKITLLSLQAV 50 >XP_013466886.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] KEH40927.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1503 Score = 75.1 bits (183), Expect = 5e-14 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MATI+ EA+LSAS+ELL++KIV+ +FVDF RSTKLD +LLEK+ TLLSLQAV Sbjct: 1 MATIVVEALLSASLELLLKKIVAEDFVDFIRSTKLDVALLEKLNVTLLSLQAV 53 >XP_003598494.2 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68745.2 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1354 Score = 74.3 bits (181), Expect = 9e-14 Identities = 37/53 (69%), Positives = 47/53 (88%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MATI+ E ILSASV+LL++KIVSGEF++FFR+ KLD LL+K++ TLLSLQAV Sbjct: 1 MATIVGEGILSASVKLLLQKIVSGEFINFFRNMKLDVPLLDKLKITLLSLQAV 53 >XP_003598501.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68752.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 829 Score = 73.2 bits (178), Expect = 2e-13 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MAT++ EA+LSASV+LL++K+VS EF+DFF S KLD +LLEK++ TLLSLQAV Sbjct: 1 MATVVGEALLSASVKLLLQKMVSSEFIDFFWSMKLDVALLEKLKITLLSLQAV 53 >XP_003598093.2 NB-ARC domain disease resistance protein [Medicago truncatula] AES68344.2 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1069 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MATI+AEA LSA VE+L+EK++S EF++FFR KLD SLLEK++TTLLSLQ++ Sbjct: 1 MATIVAEAFLSAFVEVLLEKMISHEFMNFFRCKKLDVSLLEKLKTTLLSLQSI 53 >XP_003598492.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68743.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1291 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MATI+ EA L+AS+++L++KIVSGEF D FRSTKLD LLEK+ TL+SLQAV Sbjct: 1 MATIVGEAFLTASLKVLLQKIVSGEFADLFRSTKLDVPLLEKLNITLMSLQAV 53 >XP_003598489.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68740.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1342 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MATI+ EA+LSA+++LL++KIV+ +FVDF RSTKLD +LLEK+ TLLSLQAV Sbjct: 1 MATIVVEALLSATLDLLLKKIVAEDFVDFIRSTKLDVALLEKLNVTLLSLQAV 53 >XP_004498673.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X1 [Cicer arietinum] XP_004498674.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X2 [Cicer arietinum] Length = 1238 Score = 71.6 bits (174), Expect = 8e-13 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MAT++AEA LSA VE+L+EKI+S EFV+FFRS KLD LLE ++ TLLSLQAV Sbjct: 1 MATVVAEAFLSAFVEVLLEKIISTEFVNFFRSKKLDVLLLENLKLTLLSLQAV 53 >XP_013442215.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] KEH16240.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] Length = 1982 Score = 70.5 bits (171), Expect = 2e-12 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MA+++AEA LSA VE+L+EK++S EFV+F RS KLD SLLEK++ TLLSLQAV Sbjct: 1 MASVVAEAFLSAFVEVLLEKMISTEFVNFIRSKKLDISLLEKLKLTLLSLQAV 53 >XP_003613519.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES96477.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1186 Score = 65.9 bits (159), Expect = 9e-11 Identities = 32/53 (60%), Positives = 44/53 (83%) Frame = +2 Query: 83 MATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 MA I+ E ++S SVE+L+EK+VSGEFVD FRSTKLD SLL K++ TL++++ V Sbjct: 1 MAAIVGEKMISNSVEVLLEKLVSGEFVDDFRSTKLDDSLLTKLKKTLMTIEYV 53 >XP_003598466.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68717.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1216 Score = 65.1 bits (157), Expect = 2e-10 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = +2 Query: 80 LMATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 + A + EA LSASVE+L+ KIVS EF++FF S +LD SLL+K++ TLLSLQAV Sbjct: 1 MAAAFVGEAFLSASVEVLLNKIVSNEFLNFFHSKELDVSLLKKLKITLLSLQAV 54 >XP_003598503.1 NB-ARC domain disease resistance protein, putative [Medicago truncatula] AES68754.1 NB-ARC domain disease resistance protein, putative [Medicago truncatula] Length = 179 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/51 (56%), Positives = 45/51 (88%) Frame = +2 Query: 89 TIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 +++ A+++ASV++L++KIV+GEF+DF +S KLD +LLEK++ TLLSLQAV Sbjct: 5 SLLGGALIAASVKILLDKIVAGEFIDFVQSWKLDVTLLEKLKITLLSLQAV 55 >XP_013466896.1 NB-ARC domain disease resistance protein [Medicago truncatula] KEH40937.1 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 376 Score = 64.3 bits (155), Expect = 3e-10 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = +2 Query: 80 LMATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 + A + EA LSASVE+L+ KIVS EF++FF S +LD SLL+K++ TLLSLQAV Sbjct: 1 MAAAFVGEAFLSASVEVLLNKIVSKEFLNFFHSKELDVSLLKKLKITLLSLQAV 54 >XP_007218892.1 hypothetical protein PRUPE_ppa000391mg [Prunus persica] Length = 1214 Score = 63.9 bits (154), Expect = 4e-10 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 80 LMATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 + ++ EAILSASV++L +KI S EFVD FR KLD+SL++K+E TLLSL AV Sbjct: 1 MAGALVGEAILSASVQVLFDKIGSSEFVDLFRRKKLDESLVKKLEITLLSLNAV 54 >ONI21036.1 hypothetical protein PRUPE_2G046900 [Prunus persica] Length = 1343 Score = 63.9 bits (154), Expect = 4e-10 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 80 LMATIIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 + ++ EAILSASV++L +KI S EFVD FR KLD+SL++K+E TLLSL AV Sbjct: 1 MAGALVGEAILSASVQVLFDKIGSSEFVDLFRRKKLDESLVKKLEITLLSLNAV 54 >XP_008245919.1 PREDICTED: putative disease resistance RPP13-like protein 1, partial [Prunus mume] Length = 357 Score = 63.5 bits (153), Expect = 5e-10 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = +2 Query: 92 IIAEAILSASVELLIEKIVSGEFVDFFRSTKLDKSLLEKMETTLLSLQAV 241 ++ EAILSASV++L +KI S EFVD FR KLD+SL++K+E TLLSL AV Sbjct: 3 LVGEAILSASVQVLFDKIGSSEFVDLFRRKKLDESLVKKLEITLLSLNAV 52